Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol. Determined by X-ray diffraction at 2.15 Å resolution. Released 10 Oct 2001.
Explore 1JGL in 3D Show helices and sheets RCSB PDB PDBe
1JGL contains 16 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 6 |
| β-strand | 10-12 | 3 | 7 |
| β-strand | 18-24 | 7 | 6 |
| β-strand | 34-39 | 6 | 7 |
| β-strand | 45-52 | 8 | 7 |
| β-strand | 56-59 | 4 | 7 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-71 | 5 | 6 |
| β-strand | 77-82 | 6 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 7 |
| β-strand | 99-103 | 4 | 7 |
| β-strand | 107-111 | 5 | 7 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 8 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 9 |
| β-strand | 135-145 | 11 | 9 |
| β-strand | 146 | 1 | 8 |
| β-strand | 151-154 | 4 | 10 |
| α-helix | 155-157 | 3 | |
| β-strand | 163-165 | 3 | 9 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-171 | 3 | 9 |
| β-strand | 174-184 | 11 | 9 |
| β-strand | 194-199 | 6 | 10 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-209 | 6 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 33-38 | 6 | 2 |
| α-helix | 43-44 | 2 | |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 97 | 1 | |
| β-strand | 98 | 1 | 2 |
| α-helix | 99 | 1 | |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 3 |
| β-strand | 114-118 | 5 | 4 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 4 |
| β-strand | 140 | 1 | 3 |
| β-strand | 145-150 | 6 | 5 |
| β-strand | 153-155 | 3 | 5 |
| β-strand | 159-163 | 5 | 4 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 4 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-197 | 7 | 5 |
| β-strand | 205-210 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ig kappa-chain | L | protein | 214 | Mus musculus | Q7TS98 (AlphaFold model) |
| Ig gamma-1-chain | H | protein | 218 | Mus musculus |
>1JGL_1 Ig kappa-chain (chains L) DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPS RFSGSGSGTQYSLKINSLQPEDFGTYYCHHFWSTPWTFGGGTKLEVKRADAAPTVSIFPP SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1JGL_2 Ig gamma-1-chain (chains H) QIQLVQSGPELKKPGETVRISCKASDYSFMTSGMQWVQQMPGKGLKWIGWLNTQSGVPEY AEDFKGRFAFSLETSATTAYLQINNLKNEDTATYFCATWGGNSAYWGQGTTLTVSSAKTT PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
| ID | Name | Formula | Copies |
|---|---|---|---|
| EST | Estradiol | C18 H24 O2 | 1 |
Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol. Lamminmaki, U., Kankare, J.A. J Biol Chem (2001) 276:36687-36694. DOI 10.1074/jbc.M102367200 · PubMed
Other PDB entries of the same protein (UniProt Q7TS98 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1JGL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.