1JGV: Antibody Light Chain

Structural basis for disfavored elimination reaction in catalytic antibody 1D4. Determined by X-ray diffraction at 1.85 Å resolution. Released 5 Dec 2001.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,611
Mol. weight: 47.86 kDa
Released: 5 Dec 2001

Explore 1JGV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JGV contains 17 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
α-helix	7-8	2
β-strand	10-12	3	8
β-strand	18-25	8	7
β-strand	32-39	8	8
β-strand	45-52	8	8
β-strand	56-59	4	8
α-helix	61-63	3
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-96	9	8
β-strand	100B-103	4	8
α-helix	104-106	3
β-strand	107-111	5	8
β-strand	117	1	9
α-helix	118-119	2
β-strand	120-124	5	10
α-helix	125-127	3
β-strand	135-145	11	10
β-strand	146	1	9
β-strand	151-154	4	11
α-helix	155-157	3
β-strand	159	1	11
β-strand	163-165	3	10
α-helix	166-168	3
β-strand	169-171	3	10
β-strand	174-184	11	10
β-strand	194-199	6	11
α-helix	200-202	3
β-strand	204-209	6	11

Chain L: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	4
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-155	3	6
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-186	4
β-strand	191-197	7	6
β-strand	205-210	6	6
α-helix	211-213	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Antibody Light Chain	L	protein	220	Mus musculus	Q52L64 (AlphaFold model)
Antibody Heavy Chain	H	protein	218	Mus musculus	Q91Z05 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1JGV_1 Antibody Light Chain (chains L)
EVVMTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELKRADAAPT
VSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYS
MSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1JGV_2 Antibody Heavy Chain (chains H)
EVKLVESRGGLVKPGGSLQLSCAASGFTFSGYAMSWFRLTPEKRLEWVASIYNGFRIHYL
DSVKGRFTISSDYARNILYLQMSTLRSEDTAMYYCSRGDAYSRYFDVWGAGTTVTVSAAK
TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLY
TLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Primary citation

Structural basis for a disfavored elimination reaction in catalytic antibody 1D4. Larsen, N.A., Heine, A., Crane, L. et al. J Mol Biol (2001) 314:93-102. DOI 10.1006/jmbi.2001.5112 · PubMed

Other PDB entries of the same protein (UniProt Q52L64 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R1X 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3T77 1.74 Å, S25-2- A(2-4)KDO disaccharide complex
1JGU 1.8 Å, Structural basis for disfavored elimination reaction in catalytic antibody 1D4
2R2H 2.0 Å, Structure of S25-2 in Complex with Ko
1A3R 2.1 Å, FAB fragment (antibody 8F5) complexed with peptide from human rhinovirus (serotype 2)…
1H3P 2.6 Å, Structural characterisation of a monoclonal antibody specific for the PRES1 region of…
5MP3 2.75 Å, Crystal structure of DC8E8 Fab in the complex with a 30-mer tau peptide at pH 6.5
1BBD 2.8 Å, Three dimensional structure of the FAB fragment of a neutralizing antibody to human…

Browse structure collections

About this viewer

MolViewer shows 1JGV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.