1JHK: Anti-estradiol antibody 57-2

Crystal structure of the anti-estradiol antibody 57-2. Determined by X-ray diffraction at 2.51 Å resolution. Released 10 Oct 2001.

Method: X-ray diffraction
Resolution: 2.51 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,377
Mol. weight: 47.13 kDa
Released: 10 Oct 2001

Explore 1JHK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JHK contains 13 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	6
β-strand	10-12	3	7
β-strand	18-24	7	6
β-strand	34-39	6	7
β-strand	46-52	7	7
β-strand	56-59	4	7
α-helix	61-63	3
β-strand	67-70	4	6
β-strand	78-82	5	6
α-helix	84-86	3
β-strand	88-96	9	7
β-strand	99-103	4	7
β-strand	107-111	5	7
β-strand	117	1	8
β-strand	120-124	5	9
β-strand	135-145	11	9
β-strand	146	1	8
β-strand	151-154	4	10
α-helix	155-157	3
β-strand	163-165	3	9
α-helix	166-168	3
β-strand	169-171	3	9
β-strand	174-184	11	9
β-strand	194-199	6	10
α-helix	200-202	3
β-strand	204-209	6	10

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	97	1
β-strand	98	1	2
α-helix	99	1
β-strand	102-106	5	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-187	5
β-strand	191-197	7	5
β-strand	205-210	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig kappa-chain	L	protein	214	Mus musculus	Q7TS98 (AlphaFold model)
Ig gamma-1-chain	H	protein	218	Mus musculus	Q99LC4 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1JHK_1 Ig kappa-chain (chains L)
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPS
RFSGSGSGTQYSLKINSLQPEDFGTYYCHHFWSTPWTFGGGTKLEVKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1JHK_2 Ig gamma-1-chain (chains H)
QIQLVQSGPELKKPGETVRISCKASDYSFMTSGMQWVQQMPGKGLKWIGWLNTQSGVPEY
AEDFKGRFAFSLETSATTAYLQINNLKNEDTATYFCATWGGNSAYWGQGTTLTVSSAKTT
PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC

Primary citation

Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol. Lamminmaki, U., Kankare, J.A. J Biol Chem (2001) 276:36687-36694. DOI 10.1074/jbc.M102367200 · PubMed

Other PDB entries of the same protein (UniProt Q7TS98 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VPL 1.9 Å, Crystal structure of der F 1 complexed with FAB 4C1
5TR8 2.01 Å, Crystal structure of vaccine-elicited pan- influenza H1N1 neutralizing murine antibody…
1JGL 2.15 Å, Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol

Browse structure collections

About this viewer

MolViewer shows 1JHK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.