1JKS: Death-associated protein kinase

1.5A X-ray structure of apo form of a catalytic domain of death-associated protein kinase. Determined by X-ray diffraction at 1.5 Å resolution. Released 1 Apr 2002.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,643
Mol. weight: 33.79 kDa
Released: 1 Apr 2002

Explore 1JKS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JKS contains 14 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
α-helix	9-11	3
β-strand	13-21	9	1
β-strand	25-32	8	1
β-strand	38-45	8	1
β-strand	46	1	2
α-helix	47	1
β-strand	56	1	2
α-helix	58-70	13
β-strand	76	1	3
β-strand	79-84	6	1
β-strand	88-94	7	1
β-strand	100	1	3
α-helix	101-108	8
α-helix	113-132	20
β-strand	135-136	2	4
α-helix	142-144	3
β-strand	145-147	3	3
β-strand	157-159	3	3
β-strand	166-167	2	4
β-strand	173	1	5
α-helix	181-183	3
α-helix	186-189	4
β-strand	194	1	5
α-helix	197-212	16
α-helix	222-230	9
α-helix	238-241	4
α-helix	246-253	8
α-helix	260-262	3
α-helix	266-271	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Death-associated protein kinase	A	protein	294	Homo sapiens	P53355 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JKS_1 DEATH-ASSOCIATED PROTEIN KINASE (chains A)
TVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDI
EREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLK
QILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTP
EFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYF
SNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSSAWSHPQFEK

Primary citation

Crystal structures of the catalytic domain of human protein kinase associated with apoptosis and tumor suppression. Tereshko, V., Teplova, M., Brunzelle, J. et al. Nat Struct Biol (2001) 8:899-907. DOI 10.1038/nsb1001-899 · PubMed

Other PDB entries of the same protein (UniProt P53355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GY5 1.09 Å, Crystal structure of the kelch domain of human KLHL20 in complex with DAPK1 peptide
4PF4 1.13 Å, 1.1A X-ray structure of the apo catalytic domain of death-associated protein kinase 1,…
2W4J 1.3 Å, X-ray structure of a DAP-Kinase 2-277
3GU4 1.35 Å, Crystal structure of DAPKQ23V-AMPPNP
9N2M 1.35 Å, Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-30-047SRM
4YPD 1.4 Å, Crystal Structure of DAPK1 catalytic domain in complex with the hinge binding fragment…
5AV4 1.4 Å, Crystal structure of DAPK1-genistein complex in the presence of bromide ions.
7CCW 1.4 Å, Crystal structure of death-associated protein kinase 1 in complex with resveratrol and MES
9N1T 1.43 Å, Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound SRM-26-100
3GU6 1.49 Å, Crystal structure of DAPKQ23V-ADP
9N2O 1.49 Å, Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-27-040SRM
9O73 1.49 Å, Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-30-035SRM

Browse structure collections

About this viewer

MolViewer shows 1JKS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.