1JL1: D10A E. coli ribonuclease HI

D10A E. coli ribonuclease HI. Determined by X-ray diffraction at 1.3 Å resolution. Released 27 Feb 2002.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,419
Mol. weight: 17.48 kDa
Released: 27 Feb 2002

Explore 1JL1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JL1 contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	5-13	9	1
β-strand	18-28	11	1
β-strand	31-42	12	1
α-helix	44-57	14
β-strand	64-69	6	1
α-helix	72-76	5
α-helix	77-81	5
α-helix	82-87	6
β-strand	91	1	2
α-helix	96	1
β-strand	97	1	2
α-helix	98	1
α-helix	101-110	10
β-strand	115-120	6	1
α-helix	128-142	15
β-strand	146	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribonuclease hi	A	protein	155	Escherichia coli	P0A7Y4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JL1_1 RIBONUCLEASE HI (chains A)
MLKQVEIFTAGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALK
EHAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEW
VKGHAGHPENERADELARAAAMNPTLEDTGYQVEV

Primary citation

Native-state energetics of a thermostabilized variant of ribonuclease HI. Goedken, E.R., Marqusee, S. J Mol Biol (2001) 314:863-871. DOI 10.1006/jmbi.2001.5184 · PubMed

Other PDB entries of the same protein (UniProt P0A7Y4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F21 1.4 Å, Divalent metal cofactor binding in the kinetic folding trajectory of E. Coli…
2YV0 1.4 Å, Structural and Thermodynamic Analyses of E. coli ribonuclease HI Variant with Quintuple…
3QIO 1.4 Å, Crystal Structure of HIV-1 RNase H with engineered E. coli loop and N-hydroxy…
2RN2 1.48 Å, Structural details of ribonuclease H from escherichia coli as refined to an atomic…
1JXB 1.6 Å, I53A, a point mutant of the cysteine-free variant of E. coli Rnase HI
3QIN 1.7 Å, Crystal Structure of HIV-1 RNase H p15 with engineered E. coli loop and pyrimidinol…
3HYF 1.7 Å, Crystal structure of HIV-1 RNase H p15 with engineered E. coli loop and active site…
7VSD 1.7 Å, E. coli Ribonuclease HI in complex with one Mg2+ (2)
1JL2 1.76 Å, Crystal structure of TCEO RNase H-a chimera combining the folding core from T.…
7VSA 1.76 Å, E. coli Ribonuclease HI in complex with two Mg2+
3AA4 1.79 Å, A52V E.coli RNase HI
1KVA 1.8 Å, E. Coli ribonuclease hi D134A mutant

Browse structure collections

About this viewer

MolViewer shows 1JL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.