1JNH: Fab-Estradiol Complexes

Crystal Structure of Fab-Estradiol Complexes. Determined by X-ray diffraction at 2.85 Å resolution. Released 6 Feb 2002.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Mus musculus
Chains: 8
Atoms: 12,882
Mol. weight: 186.56 kDa
Ligands: ECO
Released: 6 Feb 2002

Explore 1JNH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JNH contains 42 α-helices and 192 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	9-11	3	2
β-strand	17-22	6	3
β-strand	23-24	2	1
β-strand	27	1	1
α-helix	31-33	3
β-strand	36-41	6	2
β-strand	45-51	7	2
β-strand	55-56	2	2
α-helix	57	1
β-strand	64-69	6	3
β-strand	72-78	7	3
α-helix	82-84	3
β-strand	86-93	8	2
β-strand	98-100	3	2
β-strand	101	1	1
β-strand	104-107	4	2
β-strand	113	1	4
β-strand	116-120	5	5
α-helix	121-123	3
α-helix	124-128	5
β-strand	131-141	11	5
β-strand	142	1	4
β-strand	146-152	7	6
β-strand	155-157	3	6
β-strand	161-163	3	5
β-strand	167-169	3	5
β-strand	173-183	11	5
α-helix	184-189	6
β-strand	193-199	7	6
β-strand	202-208	7	6

Chain B: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
β-strand	10-11	2	8
β-strand	18-25	8	7
β-strand	33-39	7	8
β-strand	45-52	8	8
α-helix	53-55	3
β-strand	57-60	4	8
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-101	10	8
β-strand	104-109	6	8
β-strand	113-116	4	8
β-strand	122	1	9
β-strand	125-129	5	10
β-strand	136-137	2	10
β-strand	140-150	11	10
β-strand	151	1	9
β-strand	156-159	4	11
α-helix	160-162	3
β-strand	168-170	3	10
α-helix	171-173	3
β-strand	174-175	2	10
β-strand	180-189	10	10
β-strand	199-204	6	11
α-helix	205-207	3
β-strand	209-214	6	11

Chain C: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	12
β-strand	9	1	13
β-strand	17-22	6	14
β-strand	23	1	12
α-helix	31-33	3
β-strand	36-41	6	13
β-strand	45-48	4	13
β-strand	50-51	2	15
β-strand	55-56	2	15
α-helix	57	1
β-strand	64-69	6	14
β-strand	72-78	7	14
β-strand	87-93	7	13
β-strand	98-100	3	13
β-strand	105	1	13
β-strand	113	1	16
β-strand	116-120	5	17
α-helix	121-123	3
α-helix	124-128	5
β-strand	131-141	11	17
β-strand	142	1	16
β-strand	146-152	7	18
β-strand	155-157	3	18
β-strand	161-163	3	17
β-strand	167-168	2	17
β-strand	174-183	10	17
α-helix	184-189	6
β-strand	193-199	7	18
β-strand	202-208	7	18

Chain D: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	19
β-strand	10-11	2	20
β-strand	18-21	4	21
β-strand	22-25	4	19
α-helix	29-31	3
β-strand	33-38	6	22
β-strand	46-52	7	22
α-helix	53-55	3
β-strand	57-60	4	22
β-strand	69-73	5	21
α-helix	74-76	3
β-strand	78-83	6	21
β-strand	92-94	3	20
β-strand	95-99	5	22
β-strand	105-109	5	22
β-strand	110	1	19
β-strand	113-116	4	20
β-strand	122	1	23
β-strand	125-129	5	24
β-strand	136-137	2	24
β-strand	140-150	11	24
β-strand	151	1	23
β-strand	156-159	4	25
α-helix	160-162	3
β-strand	168-170	3	24
α-helix	171-173	3
β-strand	174-175	2	24
β-strand	180-189	10	24
β-strand	199-204	6	25
α-helix	205-207	3
β-strand	209-214	6	25

Chain E: 4 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	26
β-strand	17-22	6	27
β-strand	23	1	26
β-strand	24	1	28
β-strand	27	1	28
β-strand	36-41	6	29
β-strand	45-51	7	29
β-strand	55-56	2	29
β-strand	64-68	5	27
β-strand	73-78	6	27
α-helix	82-84	3
β-strand	87-93	7	29
β-strand	98-100	3	29
β-strand	104-105	2	29
β-strand	113	1	30
β-strand	116	1	31
β-strand	119-120	2	32
α-helix	121-123	3
α-helix	124-128	5
β-strand	131-141	11	32
β-strand	142	1	30
β-strand	146-152	7	33
β-strand	155-157	3	33
β-strand	161-163	3	32
β-strand	167-169	3	32
β-strand	173-183	11	32
α-helix	184-189	6
β-strand	193-199	7	33
β-strand	202-208	7	33

Chain F: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	34
α-helix	7-8	2
β-strand	10-11	2	35
β-strand	18-19	2	36
β-strand	22-25	4	34
β-strand	35-39	5	35
β-strand	45-52	8	35
α-helix	53-55	3
β-strand	57-59	3	35
β-strand	69	1	36
β-strand	72	1	34
β-strand	78-79	2	34
β-strand	82-83	2	36
α-helix	88-90	3
β-strand	92-99	8	35
β-strand	105-109	5	35
β-strand	110	1	34
β-strand	113-116	4	35
β-strand	122	1	37
β-strand	125-129	5	38
β-strand	136-137	2	38
β-strand	140-150	11	38
β-strand	151	1	37
β-strand	156-159	4	39
α-helix	160-162	3
β-strand	168-170	3	38
α-helix	171-173	3
β-strand	174-175	2	38
β-strand	180-189	10	38
β-strand	199-204	6	39
α-helix	205-207	3
β-strand	209-214	6	39

Chain G: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	40
β-strand	9-11	3	41
β-strand	17-24	8	40
β-strand	36-41	6	41
β-strand	45-51	7	41
β-strand	55-56	2	41
β-strand	64-69	6	40
β-strand	72-78	7	40
α-helix	82-84	3
β-strand	86-93	8	41
β-strand	98-100	3	41
β-strand	104-107	4	41
β-strand	113	1	42
β-strand	116-120	5	43
α-helix	121-123	3
α-helix	124-128	5
β-strand	131-141	11	43
β-strand	142	1	42
β-strand	146-152	7	44
β-strand	155-157	3	44
β-strand	161-163	3	43
β-strand	167-169	3	43
β-strand	173-183	11	43
α-helix	184-189	6
β-strand	193-199	7	44
β-strand	202-208	7	44

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	45
β-strand	10-11	2	46
β-strand	18-24	7	45
β-strand	33-39	7	46
β-strand	46-52	7	46
α-helix	53-55	3
β-strand	57-60	4	46
α-helix	62-65	4
β-strand	69-73	5	45
β-strand	78-83	6	45
α-helix	88-90	3
β-strand	92-101	10	46
β-strand	104-109	6	46
β-strand	110	1	45
β-strand	113-116	4	46
β-strand	122	1	47
β-strand	125-129	5	48
β-strand	136-137	2	48
β-strand	140-150	11	48
β-strand	151	1	47
β-strand	156-159	4	49
α-helix	160-162	3
β-strand	168-170	3	48
α-helix	171-173	3
β-strand	174-175	2	48
β-strand	180-189	10	48
β-strand	199-204	6	49
α-helix	205-207	3
β-strand	209-214	6	49

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
monoclonal anti-estradiol 10G6D6 Fab light chain	A, C, E, G	protein	212	Mus musculus	P01843 (AlphaFold model)
monoclonal anti-estradiol 10G6D6 Fab heavy chain	B, D, F, H	protein	218	Mus musculus

Sequence of entity 1 (A, C, E, G), FASTA

>1JNH_1 monoclonal anti-estradiol 10G6D6 Fab light chain (chains A, C, E, G)
QAVVTQESALTTSPGETVTLTCRSSSGAITTSHYANWIQEKPDHLFTGLISGTNNRAPGV
PARFSGSLIGDKAALTITGAQTEDEAIYICALWFSNQFIFGSGTKVTVLGQPKSSPSVTL
FPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSY
LTLTARAWERHSSYSCQVTHEGHTVEKSLSAA

Sequence of entity 2 (B, D, F, H), FASTA

>1JNH_2 monoclonal anti-estradiol 10G6D6 Fab heavy chain (chains B, D, F, H)
EVQLQQSGAELARPGASVKLSCRTSGYSFTTYWMQWVRQRPGQGLEWIAAIYPGDDDARY
TQKFKGKATLTADRSSSIVYLQLNSLTSEDSAVYSCSRGRSLYYTMDYWGQGTSVTVSSA
KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVSWNTGSLSSGVHTFPAVLQSDL
YTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP

Ligands and cofactors

ID	Name	Formula	Copies
ECO	Estradiol-6 carboxyl-methyl-oxime	C20 H25 N O5	4

Primary citation

Highly specific anti-estradiol antibodies: structural characterisation and binding diversity. Monnet, C., Bettsworth, F., Stura, E.A. et al. J Mol Biol (2002) 315:699-712. DOI 10.1006/jmbi.2001.5284 · PubMed

Other PDB entries of the same protein (UniProt P01843 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1JN6 2.7 Å, Crystal Structure of Fab-Estradiol Complexes

Browse structure collections

About this viewer

MolViewer shows 1JNH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.