1JXG: Plastocyanin a

The 1.6 A Resolution Crystal Structure of a Mutant Poplar Plastocyanin Bearing a 21-25 Engeneered Disulfide Bridge. Determined by X-ray diffraction at 1.6 Å resolution. Released 19 Dec 2001.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Populus nigra
Chains: 2
Atoms: 1,781
Mol. weight: 21.4 kDa
Ligands: CU1
Released: 19 Dec 2001

Explore 1JXG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JXG contains 6 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1-5	5	1
β-strand	14-15	2	1
β-strand	18-21	4	2
β-strand	26-31	6	1
β-strand	37	1	3
β-strand	40	1	2
α-helix	43-45	3
α-helix	52-54	3
β-strand	63	1	3
β-strand	69-73	5	1
β-strand	78-83	6	2
α-helix	88-90	3
β-strand	93-98	6	2

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1-5	5	4
β-strand	14-15	2	4
β-strand	18-21	4	5
β-strand	26-31	6	4
β-strand	37	1	6
β-strand	40-41	2	5
α-helix	43-45	3
α-helix	52-55	4
β-strand	63	1	6
β-strand	69-73	5	4
β-strand	78-83	6	5
α-helix	85-87	3
β-strand	93-98	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plastocyanin a	A, B	protein	100	Populus nigra	P00299 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1JXG_1 PLASTOCYANIN A (chains A, B)
MIDVLLGADDGSLAFVPSEFSCSPGCKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSE
EDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN

Ligands and cofactors

ID	Name	Formula	Copies
CU1	Copper (I) ion	Cu	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

The 1.6 A resolution crystal structure of a mutant plastocyanin bearing a 21-25 engineered disulfide bridge. Milani, M., Andolfi, L., Cannistraro, S. et al. Acta Crystallogr D Biol Crystallogr (2001) 57:1735-1738. DOI 10.1107/S0907444901013221 · PubMed

Other PDB entries of the same protein (UniProt P00299 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DP9 1.0 Å, The 1.00 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 6.0
4DPB 1.0 Å, The 1.00 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 8.0
4DPA 1.05 Å, The 1.05 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 6.0
4DPC 1.06 Å, The 1.06 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 8.0
4DP8 1.07 Å, The 1.07 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 4.0
4DP7 1.08 Å, The 1.08 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 4.0
1PLC 1.33 Å, Accuracy and precision in protein crystal structure analysis: restrained least-squares…
1PNC 1.6 Å, Accuracy and precision in protein crystal structure analysis: two independent…
1PND 1.6 Å, Accuracy and precision in protein crystal structure analysis: two independent…
2PCY 1.8 Å, The crystal structure of poplar apoplastocyanin at 1.8-Å resolution. The geometry of the…
5PCY 1.8 Å, Crystal structure analyses of reduced (CUI) poplar plastocyanin at six PH values
3PCY 1.9 Å, The crystal structure of mercury-substituted poplar plastocyanin at 1.9-Å resolution

Browse structure collections

About this viewer

MolViewer shows 1JXG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.