1K4W: Nuclear receptor ROR-beta

X-ray structure of the orphan nuclear receptor ROR beta ligand-binding domain in the active conformation. Determined by X-ray diffraction at 1.9 Å resolution. Released 9 Apr 2002.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,223
Mol. weight: 30.96 kDa
Ligands: STE
Released: 9 Apr 2002

Explore 1K4W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K4W contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	209-225	17
α-helix	231-235	5
β-strand	241	1	1
α-helix	244-251	8
α-helix	255-278	24
α-helix	281-284	4
α-helix	288-307	20
α-helix	308-310	3
β-strand	311-312	2	1
β-strand	317-320	4	1
β-strand	323-325	3	1
α-helix	327-333	7
α-helix	336-350	15
α-helix	356-367	12
α-helix	378-398	21
α-helix	405-410	6
α-helix	413-433	21
α-helix	435-440	6
α-helix	444-450	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	688-695	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor ROR-beta	A	protein	252	Rattus norvegicus	P45446 (AlphaFold model)
steroid receptor coactivator-1	B	protein	15		Q15788 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1K4W_1 Nuclear receptor ROR-beta (chains A)
GQLAPGITMSEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQ
QCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLF
EGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLLEPRK
VQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPDIVNT
LFPPLYKELFNP

Sequence of entity 2 (B), FASTA

>1K4W_2 steroid receptor coactivator-1 (chains B)
RHKILHRLLQEGSPS

Ligands and cofactors

ID	Name	Formula	Copies
STE	Stearic acid	C18 H36 O2	1

Primary citation

X-ray structure of the orphan nuclear receptor RORbeta ligand-binding domain in the active conformation. Stehlin, C., Wurtz, J.M., Steinmetz, A. et al. EMBO J (2001) 20:5822-5831. DOI 10.1093/emboj/20.21.5822 · PubMed

Other PDB entries of the same protein (UniProt P45446 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NQ7 1.5 Å, Characterization of ligands for the orphan nuclear receptor RORbeta
1N4H 2.1 Å, Characterization of ligands for the orphan nuclear receptor RORbeta

Browse structure collections

About this viewer

MolViewer shows 1K4W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.