1K6U: Cyclic Bovine Pancreatic Trypsin Inhibitor

Crystal Structure of Cyclic Bovine Pancreatic Trypsin Inhibitor. Determined by X-ray diffraction at 1.0 Å resolution. Released 19 Dec 2001.

Method: X-ray diffraction
Resolution: 1.0 Å
Chains: 1
Atoms: 673
Mol. weight: 7.28 kDa
Released: 19 Dec 2001

Explore 1K6U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K6U contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
α-helix	8-9	2
β-strand	18-24	7	1
β-strand	29-35	7	1
β-strand	45	1	1
α-helix	48-55	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pancreatic trypsin inhibitor	A	protein	58		P00974 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1K6U_1 PANCREATIC TRYPSIN INHIBITOR (chains A)
RPDFCLEPPYAGACRARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCLRTCGGA

Primary citation

Crystal structure of a cyclic form of bovine pancreatic trypsin inhibitor. Botos, I., Wu, Z., Lu, W. et al. FEBS Lett (2001) 509:90-94. DOI 10.1016/S0014-5793(01)03113-1 · PubMed

Other PDB entries of the same protein (UniProt P00974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G6X 0.86 Å, Ultra high resolution structure of bovine pancreatic trypsin inhibitor (BPTI) mutant…
5PTI 1.0 Å, Structure of bovine pancreatic trypsin inhibitor. Results of joint neutron and X-ray…
1BPI 1.09 Å, The structure of bovine pancreatic trypsin inhibitor at 125K: definition of…
2ZJX 1.09 Å, Bovine pancreatic trypsin inhibitor (BPTI) containing only the [5,55] disulfide bond
2ZVX 1.09 Å, Structure of a BPTI-[5,55] variant containing Gly/Val at the 14/38th positions
5XX2 1.12 Å, A BPTI-[5,55] variant with C14GA38L mutations
5XX3 1.12 Å, A BPTI-[5,55] variant with C14GA38G mutations
7PH1 1.18 Å, Trypsin in complex with BPTI mutant (2S)-2-amino-4-monofluorobutanoic acid
9PTI 1.22 Å, Basic pancreatic trypsin inhibitor (met 52 oxidized)
4Y0Y 1.25 Å, Trypsin in complex with with BPTI
3P95 1.3 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant…
3WNY 1.3 Å, A simplified BPTI variant with poly Lys amino acid tag (C3K) at the C-terminus

Browse structure collections

About this viewer

MolViewer shows 1K6U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.