1K8F: Adenylyl cyclase-associated protein

Crystal structure of the human C-terminal CAP1-adenylyl cyclase associated protein. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 Jul 2003.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,864
Mol. weight: 69.45 kDa
Released: 1 Jul 2003

Explore 1K8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K8F contains 4 α-helices and 71 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 1 helix, 18 β-strands

Element	Residues	Length	Sheet
β-strand	321-325	5	1
β-strand	328-332	5	1
β-strand	335	1	2
β-strand	340-342	3	2
β-strand	350-354	5	1
β-strand	357	1	2
β-strand	360-367	8	2
β-strand	369-373	5	1
β-strand	376-385	10	2
β-strand	388-392	5	1
β-strand	395-401	7	2
β-strand	407-411	5	1
β-strand	414-419	6	2
β-strand	428-432	5	1
β-strand	435-443	9	2
β-strand	447-452	6	2
α-helix	453-454	2
β-strand	456-461	6	3
β-strand	466-471	6	3

Chain B: 1 helix, 17 β-strands

Element	Residues	Length	Sheet
β-strand	321-325	5	3
β-strand	328-332	5	3
β-strand	335	1	4
β-strand	340-342	3	4
β-strand	350-354	5	3
β-strand	357-367	11	4
β-strand	369-373	5	3
β-strand	376-385	10	4
β-strand	388-392	5	3
β-strand	395-401	7	4
β-strand	407-411	5	3
β-strand	414-419	6	4
β-strand	428-432	5	3
β-strand	435-443	9	4
β-strand	447-452	6	4
α-helix	453-454	2
β-strand	456-461	6	1
β-strand	466-471	6	1

Chain C: 1 helix, 18 β-strands

Element	Residues	Length	Sheet
β-strand	321-325	5	5
β-strand	328-332	5	5
β-strand	335	1	6
β-strand	340-342	3	6
β-strand	350-354	5	5
β-strand	357	1	6
β-strand	360-367	8	6
β-strand	369-373	5	5
β-strand	376-385	10	6
β-strand	388-392	5	5
β-strand	395-401	7	6
β-strand	407-411	5	5
β-strand	414-419	6	6
β-strand	428-432	5	5
β-strand	435-443	9	6
β-strand	447-453	7	6
α-helix	454	1
β-strand	456-461	6	7
β-strand	466-471	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adenylyl cyclase-associated protein	A, B, C, D	protein	157	Homo sapiens	Q01518 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1K8F_1 ADENYLYL CYCLASE-ASSOCIATED PROTEIN (chains A, B, C, D)
PAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKL
GLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMN
VLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG

Primary citation

Crystal structure of the actin binding domain of the cyclase-associated protein. Dodatko, T., Fedorov, A.A., Grynberg, M. et al. Biochemistry (2004) 43:10628-10641. DOI 10.1021/bi049071r · PubMed

Other PDB entries of the same protein (UniProt Q01518 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Q7O 3.02 Å, One CAP-1 Bound to the Pointed End of F-actin
9XYE 3.18 Å, Two CAP-1 Bound to the Pointed End of F-actin
9Y52 3.46 Å, One CAP-1 Bound to the Pointed End of Cofilin F-actin
9Y9J 3.58 Å, Two CAP-1 Bound to the Pointed End of Cofilin F-actin

Browse structure collections

About this viewer

MolViewer shows 1K8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.