Crystal structure of calcium-free (or apo) human S100A6; CYS3MET mutant (selenomethionine derivative). Determined by X-ray diffraction at 1.15 Å resolution. Released 10 Apr 2002.
Explore 1K8U in 3D Show helices and sheets RCSB PDB PDBe
1K8U contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-20 | 17 | |
| β-strand | 28-30 | 3 | 1 |
| α-helix | 31-41 | 11 | |
| α-helix | 45-47 | 3 | |
| α-helix | 51-62 | 12 | |
| β-strand | 67-69 | 3 | 1 |
| α-helix | 70-84 | 15 | |
| α-helix | 86-88 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| S100A6 | A | protein | 90 | Homo sapiens | P06703 (AlphaFold model) |
>1K8U_1 S100A6 (chains A) MAMPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDL DRNKDQEVNFQEYVTFLGALALIYNEALKG
Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution. Otterbein, L.R., Kordowska, J., Witte-Hoffmann, C. et al. Structure (2002) 10:557-567. DOI 10.1016/S0969-2126(02)00740-2 · PubMed
Other PDB entries of the same protein (UniProt P06703 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1K8U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.