1KB5: KB5-C20 T-cell antigen receptor

Murine T-cell receptor variable domain/fab complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 8 Apr 1998.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 4
Atoms: 5,438
Mol. weight: 73.5 kDa
Released: 8 Apr 1998

Explore 1KB5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KB5 contains 9 α-helices and 70 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	9-12	4	2
β-strand	18-24	7	1
β-strand	29-31	3	3
β-strand	34-37	4	2
β-strand	44-47	4	2
β-strand	50	1	3
β-strand	55-58	4	1
β-strand	62-67	6	1
β-strand	72-77	6	1
α-helix	82-84	3
β-strand	86-89	4	2
β-strand	91-92	2	4
β-strand	93-94	2	3
β-strand	105-106	2	4
β-strand	110-114	5	2

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	5
β-strand	12	1	6
β-strand	20-25	6	5
β-strand	31-37	7	7
β-strand	43-49	7	7
β-strand	54-60	7	5
β-strand	63-69	7	5
β-strand	74-80	7	5
β-strand	86-95	8	7
α-helix	96-98	3
β-strand	107-108	2	7
β-strand	112-114	3	7
β-strand	115	1	6

Chain H: 2 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	13
β-strand	10-12	3	14
β-strand	18-25	8	13
β-strand	33-39	7	5
α-helix	40-42	3
β-strand	45-51	7	5
β-strand	57-59	3	5
β-strand	67-72	6	13
β-strand	77-82	6	13
β-strand	88-89	2	14
β-strand	90-95	6	5
β-strand	103	1	5
β-strand	108-111	4	14
β-strand	117	1	15
β-strand	120-124	5	16
β-strand	136-145	10	16
β-strand	146	1	15
β-strand	151-154	4	17
β-strand	163-171	9	16
β-strand	174-183	10	16
β-strand	194-199	6	17
α-helix	200-202	3
β-strand	204-209	6	17

Chain L: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	8
β-strand	10-12	3	9
β-strand	19-24	6	8
β-strand	33-38	6	9
β-strand	45-49	5	9
β-strand	53-54	2	9
α-helix	55	1
β-strand	62-67	6	8
β-strand	70-75	6	8
α-helix	80-82	3
β-strand	84-90	7	9
α-helix	96	1
β-strand	97	1	5
β-strand	98	1	9
β-strand	102-105	4	9
β-strand	111	1	10
β-strand	114-118	5	11
α-helix	122-127	6
β-strand	130-139	10	11
β-strand	140	1	10
β-strand	145-151	7	12
β-strand	153-154	2	12
β-strand	159-163	5	11
β-strand	173-181	9	11
α-helix	183-187	5
β-strand	191-197	7	12
β-strand	205-210	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KB5-C20 T-cell antigen receptor	A	protein	115	Mus musculus
KB5-C20 T-cell antigen receptor	B	protein	117	Mus musculus	P04214 (AlphaFold model)
Antibody desire-1	L	protein	214	Mus musculus	P01837 (AlphaFold model)
Antibody desire-1	H	protein	219	Mus musculus	P01865 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KB5_1 KB5-C20 T-CELL ANTIGEN RECEPTOR (chains A)
QQVRQSPQSLTVWEGETAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGR
FTIFFNKREKKLSLHITDSQPGDSATYFCAARYQGGRALIFGTGTTVSVSPGSAD

Sequence of entity 2 (B), FASTA

>1KB5_2 KB5-C20 T-CELL ANTIGEN RECEPTOR (chains B)
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKS
LPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAAPDWGASAETLYFGSGTRLTVL

Sequence of entity 3 (L), FASTA

>1KB5_3 ANTIBODY DESIRE-1 (chains L)
DIQMTQSPASLSASVGETVTITCRASKNIYSYLAWYQQKQGKSPQLLVYNAKTLGEGVPS
RFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 4 (H), FASTA

>1KB5_4 ANTIBODY DESIRE-1 (chains H)
EVQLQQSGPELEKPGASVKISCKASGYSFTGYNMNWVKQSNGKSLEWIGNIDPYYGGISY
NQKFKGRATLTVDKSSSTAYMQLKSLTSEDSAVYYCARSRTDLYYFDYWGQGTTLTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Primary citation

The three-dimensional structure of a T-cell antigen receptor V alpha V beta heterodimer reveals a novel arrangement of the V beta domain. Housset, D., Mazza, G., Gregoire, C. et al. EMBO J (1997) 16:4205-4216. DOI 10.1093/emboj/16.14.4205 · PubMed

Other PDB entries of the same protein (UniProt P04214 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FO0 2.5 Å, Murine alloreactive scFv TCR-peptide-MHC class I molecule complex
1NAM 2.7 Å, Murine alloreactive scFv TCR-peptide-MHC class I molecule complex
1KJ2 2.71 Å, Murine Alloreactive ScFv TCR-Peptide-MHC Class I Molecule Complex
2OL3 2.9 Å, crystal structure of BM3.3 ScFV TCR in complex with PBM8-H-2KBM8 MHC class I molecule

Browse structure collections

About this viewer

MolViewer shows 1KB5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.