1KJ0: Small serine protease inhibitor sgti

Solution structure of the small serine protease inhibitor sgti. Determined by solution NMR. Released 12 Dec 2001.

Method: Solution NMR
Chains: 1
Atoms: 262
Mol. weight: 3.83 kDa
Released: 12 Dec 2001

Explore 1KJ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KJ0 contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	16	1	1
β-strand	20	1	2
β-strand	23	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine protease inhibitor I	A	protein	35		O46162 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KJ0_1 SERINE PROTEASE INHIBITOR I (chains A)
EQECTPGQTKKQDCNTCNCTPTGVWACTRKGCPPH

Primary citation

Comparative structure analysis of proteinase inhibitors from the desert locust, Schistocerca gregaria. Gaspari, Z., Patthy, A., Graf, L. et al. Eur J Biochem (2002) 269:527-537. DOI 10.1046/j.0014-2956.2001.02685.x · PubMed

Other PDB entries of the same protein (UniProt O46162 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XTT 0.93 Å, Bovine trypsin in complex with evolutionary enhanced Schistocerca gregaria protease…
2F91 1.2 Å, 1.2A resolution structure of a crayfish trypsin complexed with a peptide inhibitor, SGTI
3TVJ 1.28 Å, Catalytic fragment of MASP-2 in complex with its specific inhibitor developed by…
4DJZ 3.2 Å, Catalytic fragment of masp-1 in complex with its specific inhibitor developed by…
1KGM Solution structure of the small serine protease inhibitor sgci
1KIO Solution structure of the small serine protease inhibitor SGCI[L30R, K31M]

Browse structure collections

About this viewer

MolViewer shows 1KJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.