Crystal Structure of the GABA(A) Receptor Associated Protein, GABARAP. Determined by X-ray diffraction at 2.0 Å resolution. Released 24 Apr 2002.
Explore 1KJT in 3D Show helices and sheets RCSB PDB PDBe
1KJT contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 1 |
| α-helix | 36 | 1 | |
| α-helix | 42-44 | 3 | |
| β-strand | 48-52 | 5 | 1 |
| β-strand | 56 | 1 | 2 |
| α-helix | 57-68 | 12 | |
| β-strand | 77-79 | 3 | 1 |
| β-strand | 90 | 1 | 2 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gabarap | A | protein | 119 | Rattus norvegicus | P60517 (AlphaFold model) |
>1KJT_1 GABARAP (chains A) ASMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVG QFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
| ID | Name | Formula | Copies |
|---|---|---|---|
| NI | Nickel (II) ion | Ni | 2 |
Water and common crystallization additives (NA) are not listed.
Crystal structure of the GABA(A)-receptor-associated protein, GABARAP. Bavro, V.N., Sola, M., Bracher, A. et al. EMBO Rep (2002) 3:183-189. DOI 10.1093/embo-reports/kvf026 · PubMed
Other PDB entries of the same protein (UniProt P60517 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1KJT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.