1KJV: TAP-B-associated rat MHC class I molecule

TAP-B-associated rat MHC class I molecule. Determined by X-ray diffraction at 1.48 Å resolution. Released 18 Dec 2002.

Method: X-ray diffraction
Resolution: 1.48 Å
Organism: Rattus norvegicus
Chains: 3
Atoms: 3,670
Mol. weight: 46.2 kDa
Released: 18 Dec 2002

Explore 1KJV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KJV contains 13 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
α-helix	20	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	40	1	1
α-helix	47-49	3
α-helix	52-84	33
β-strand	94-103	10	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-149	12
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-180	16
β-strand	183	1	2
β-strand	186-193	8	3
β-strand	199-208	10	3
β-strand	209	1	2
β-strand	214-219	6	4
β-strand	222-223	2	4
α-helix	225-227	3
β-strand	229-230	2	3
α-helix	231-233	3
β-strand	234-235	2	3
β-strand	241-249	9	3
α-helix	254-256	3
β-strand	257-262	6	4
β-strand	270-272	3	4

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
α-helix	4-5	2
β-strand	6-11	6	6
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	36-41	6	7
β-strand	44-45	2	7
α-helix	46	1
β-strand	50-51	2	6
α-helix	52-54	3
β-strand	55-56	2	6
β-strand	62-70	9	6
β-strand	78-83	6	7
β-strand	91-94	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mature alpha chain of major histocompatibility complex class I antigen (HEAVY CHAIN)	A	protein	284	Rattus norvegicus	Q95565 (AlphaFold model)
beta-2-microglobulin	B	protein	100	Rattus norvegicus	P07151 (AlphaFold model)
peptide NPR	P	protein	9		Q9JJP9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KJV_1 Mature alpha chain of major histocompatibility complex class I antigen (HEAVY CHAIN) (chains A)
GSHSLRYFDIAVSRPGLGEPRYISVGYVDDTEFARYDSDAENRRYQPRARWMEREGPEYW
ERNTPIYKGKEQTFRVNLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYEQFAYDG
RDYIALNEDLKTWTAADFAARISRNKLERDGFADLHRAYLEGECVESLRRYLELGKETLL
RSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGT
FQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWEPLEHHHHHH

Sequence of entity 2 (B), FASTA

>1KJV_2 beta-2-microglobulin (chains B)
MIQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKD
WSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

Sequence of entity 3 (P), FASTA

>1KJV_3 peptide NPR (chains P)
NPRAMQALL

Primary citation

Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B. Rudolph, M.G., Stevens, J., Speir, J.A. et al. J Mol Biol (2002) 324:975-990. DOI 10.1016/S0022-2836(02)01095-1 · PubMed

Browse structure collections

About this viewer

MolViewer shows 1KJV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.