Catalytic Domain of Human Phenylalanine Hydroxylase (Fe(II)) in Complex with Tetrahydrobiopterin and Thienylalanine. Determined by X-ray diffraction at 2.5 Å resolution. Released 28 Jan 2003.
Explore 1KW0 in 3D Show helices and sheets RCSB PDB PDBe
1KW0 contains 19 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 124 | 1 | 1 |
| α-helix | 128-131 | 4 | |
| β-strand | 136 | 1 | 2 |
| α-helix | 147-150 | 4 | |
| α-helix | 152-166 | 15 | |
| α-helix | 173-176 | 4 | |
| α-helix | 181-201 | 21 | |
| β-strand | 202 | 1 | 3 |
| α-helix | 204-217 | 14 | |
| β-strand | 220 | 1 | 4 |
| β-strand | 223 | 1 | 4 |
| α-helix | 227-238 | 12 | |
| β-strand | 241-244 | 4 | 5 |
| β-strand | 248 | 1 | 2 |
| α-helix | 251-257 | 7 | |
| α-helix | 258-260 | 3 | |
| β-strand | 262-265 | 4 | 5 |
| α-helix | 283-284 | 2 | |
| α-helix | 285-290 | 6 | |
| α-helix | 291-294 | 4 | |
| α-helix | 297-310 | 14 | |
| α-helix | 315-325 | 11 | |
| α-helix | 326-330 | 5 | |
| β-strand | 333-334 | 2 | 3 |
| β-strand | 341-342 | 2 | 3 |
| α-helix | 345-348 | 4 | |
| α-helix | 351-357 | 7 | |
| β-strand | 363-366 | 4 | 3 |
| α-helix | 369-372 | 4 | |
| β-strand | 385-389 | 5 | 3 |
| α-helix | 392-403 | 12 | |
| β-strand | 412-415 | 4 | 1 |
| β-strand | 420-423 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phenylalanine-4-hydroxylase | A | protein | 325 | Homo sapiens | P00439 (AlphaFold model) |
>1KW0_1 Phenylalanine-4-hydroxylase (chains A) GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFA DIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHED NIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPD ICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKA YGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNF AATIPRPFSVRYDPYTQRIEVLDNT
| ID | Name | Formula | Copies |
|---|---|---|---|
| TIH | BETA(2-thienyl)alanine | C7 H9 N O2 S | 1 |
| H4B | 5,6,7,8-tetrahydrobiopterin | C9 H15 N5 O3 | 1 |
| FE2 | FE (II) ion | Fe | 1 |
Crystal Structure of the Ternary Complex of the Catalytic Domain of Human Phenylalanine Hydroxylase with Tetrahydrobiopterin and 3-(2-thienyl)-L-alanine, and its Implications for the Mechanism of Catalysis and Substrate Activation. Andersen, O.A., Flatmark, T., Hough, E. J Mol Biol (2002) 320:1095-1108. DOI 10.1016/S0022-2836(02)00560-0 · PubMed
Other PDB entries of the same protein (UniProt P00439 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1KW0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.