1KY7: The ap-2 clathrin adaptor alpha-appendage

The ap-2 clathrin adaptor alpha-appendage in complex with amphiphysin fxdxf. Determined by X-ray diffraction at 2.15 Å resolution. Released 12 Jun 2002.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,196
Mol. weight: 29.06 kDa
Released: 12 Jun 2002

Explore 1KY7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KY7 contains 7 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	705-708	4
β-strand	714-718	5	1
β-strand	722-731	10	1
β-strand	734-743	10	1
β-strand	749	1	2
β-strand	750-757	8	3
α-helix	760-765	6
β-strand	766-770	5	1
β-strand	777	1	2
β-strand	782-791	10	1
β-strand	800-807	8	3
β-strand	810-817	8	3
α-helix	822-825	4
β-strand	826-828	3	4
α-helix	833-840	8
α-helix	846-848	3
β-strand	849-855	7	4
α-helix	862-872	11
β-strand	875-877	3	4
β-strand	887-894	8	4
β-strand	899-909	11	4
β-strand	914-921	8	4
α-helix	924-935	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-adaptin C	A	protein	247	Mus musculus	P17427 (AlphaFold model)
Amphiphysin	P	protein	10		P49418 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KY7_1 ALPHA-ADAPTIN C (chains A)
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLN
FTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTF
QNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIG
FGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLC
ELLSEQF

Sequence of entity 2 (P), FASTA

>1KY7_2 AMPHIPHYSIN (chains P)
SFFEDNFVPE

Primary citation

Accessory protein recruitment motifs in clathrin-mediated endocytosis. Brett, T.J., Traub, L.M., Fremont, D.H. Structure (2002) 10:797-809. DOI 10.1016/S0969-2126(02)00784-0 · PubMed

Other PDB entries of the same protein (UniProt P17427 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KYF 1.22 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1QTS 1.4 Å, Crystal structure of the ap-2 clathrin adaptor alpha-appendage
7OHI 1.41 Å, FCHO1-peptide-AP2 alpha ear complex
1QTP 1.6 Å, Crystal structure of the ap-2 clathrin adaptor alpha-appendage
2VJ0 1.6 Å, Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex,…
1KYU 1.8 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1B9K 1.9 Å, Alpha-adaptin appendage domain, from clathrin adaptor AP2
1W80 1.9 Å, Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex,…
3HS8 1.9 Å, Intersectin 1-peptide-AP2 alpha ear complex
9PUE 1.91 Å, Structure of Alpha Appendage of AP2 bound to the FxDxF motif derived of CCDC32
1KY6 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
1KYD 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide

Browse structure collections

About this viewer

MolViewer shows 1KY7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.