Poliovirus 3C proteinase. Determined by X-ray diffraction at 2.1 Å resolution. Released 10 Apr 2002.
Explore 1L1N in 3D Show helices and sheets RCSB PDB PDBe
1L1N contains 10 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-14 | 9 | |
| β-strand | 15-20 | 6 | 1 |
| β-strand | 23-31 | 9 | 1 |
| β-strand | 32 | 1 | 2 |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 39-41 | 3 | |
| β-strand | 46-49 | 4 | 1 |
| β-strand | 52-63 | 12 | 1 |
| β-strand | 69-77 | 9 | 1 |
| β-strand | 83 | 1 | 2 |
| α-helix | 87-89 | 3 | |
| β-strand | 97-104 | 8 | 1 |
| β-strand | 112-127 | 16 | 1 |
| β-strand | 130-139 | 10 | 1 |
| β-strand | 150-153 | 4 | 1 |
| β-strand | 156-165 | 10 | 1 |
| β-strand | 168-173 | 6 | 1 |
| α-helix | 176-179 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-14 | 11 | |
| β-strand | 15-20 | 6 | 1 |
| β-strand | 23-31 | 9 | 1 |
| β-strand | 32 | 1 | 3 |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 39-41 | 3 | |
| β-strand | 46-49 | 4 | 1 |
| β-strand | 52-63 | 12 | 1 |
| β-strand | 69-78 | 10 | 1 |
| α-helix | 82 | 1 | |
| β-strand | 83 | 1 | 3 |
| α-helix | 84 | 1 | |
| α-helix | 87-89 | 3 | |
| β-strand | 97-104 | 8 | 1 |
| β-strand | 112-127 | 16 | 1 |
| β-strand | 130-138 | 9 | 1 |
| β-strand | 150-153 | 4 | 1 |
| β-strand | 156-164 | 9 | 1 |
| β-strand | 169-173 | 5 | 1 |
| α-helix | 176-179 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Genome polyprotein: Picornain 3C | A, B | protein | 183 | Human poliovirus 1 | P03300 (AlphaFold model) |
>1L1N_1 Genome polyprotein: Picornain 3C (chains A, B) GPGFDYAVAMAKRNIVTATTSKGEFTMLGVHDNVAILPTHASPGESIVIDGKEVEILDAK ALEDQAGTNLEITIITLKRNEKFRDIRPHIPTQITETNDGVLIVNTSKYPNMYVPVGAVT EQGYLNLGGRQTARTLMYNFPTRAGQCGGVITCTGKVIGMHVGGNGSHGFAAALKRSYFT QSQ
Refined X-ray crystallographic structure of the poliovirus 3C gene product. Mosimann, S.C., Cherney, M.M., Sia, S. et al. J Mol Biol (1997) 273:1032-1047. DOI 10.1006/jmbi.1997.1306 · PubMed
Other PDB entries of the same protein (UniProt P03300 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1L1N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.