1L1N: Poliovirus 3C proteinase

Poliovirus 3C proteinase. Determined by X-ray diffraction at 2.1 Å resolution. Released 10 Apr 2002.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Human poliovirus 1
Chains: 2
Atoms: 2,822
Mol. weight: 39.29 kDa
Released: 10 Apr 2002

Explore 1L1N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1L1N contains 10 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
β-strand	15-20	6	1
β-strand	23-31	9	1
β-strand	32	1	2
β-strand	34-38	5	1
α-helix	39-41	3
β-strand	46-49	4	1
β-strand	52-63	12	1
β-strand	69-77	9	1
β-strand	83	1	2
α-helix	87-89	3
β-strand	97-104	8	1
β-strand	112-127	16	1
β-strand	130-139	10	1
β-strand	150-153	4	1
β-strand	156-165	10	1
β-strand	168-173	6	1
α-helix	176-179	4

Chain B: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	4-14	11
β-strand	15-20	6	1
β-strand	23-31	9	1
β-strand	32	1	3
β-strand	34-38	5	1
α-helix	39-41	3
β-strand	46-49	4	1
β-strand	52-63	12	1
β-strand	69-78	10	1
α-helix	82	1
β-strand	83	1	3
α-helix	84	1
α-helix	87-89	3
β-strand	97-104	8	1
β-strand	112-127	16	1
β-strand	130-138	9	1
β-strand	150-153	4	1
β-strand	156-164	9	1
β-strand	169-173	5	1
α-helix	176-179	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein: Picornain 3C	A, B	protein	183	Human poliovirus 1	P03300 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1L1N_1 Genome polyprotein: Picornain 3C (chains A, B)
GPGFDYAVAMAKRNIVTATTSKGEFTMLGVHDNVAILPTHASPGESIVIDGKEVEILDAK
ALEDQAGTNLEITIITLKRNEKFRDIRPHIPTQITETNDGVLIVNTSKYPNMYVPVGAVT
EQGYLNLGGRQTARTLMYNFPTRAGQCGGVITCTGKVIGMHVGGNGSHGFAAALKRSYFT
QSQ

Primary citation

Refined X-ray crystallographic structure of the poliovirus 3C gene product. Mosimann, S.C., Cherney, M.M., Sia, S. et al. J Mol Biol (1997) 273:1032-1047. DOI 10.1006/jmbi.1997.1306 · PubMed

Other PDB entries of the same protein (UniProt P03300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DCD 1.69 Å, 1.6A resolution structure of PolioVirus 3C Protease Containing a covalently bound…
9U04 1.7 Å, LX-2D6 (Fab) - Polio 1 (VLP) complex
1RA6 2.0 Å, Poliovirus Polymerase Full Length Apo Structure
4NLR 2.0 Å, Poliovirus Polymerase - C290S Loop Mutant
4NLS 2.0 Å, Poliovirus Polymerase - S288A Loop Mutant
4NLU 2.1 Å, Poliovirus Polymerase - G289A Loop Mutant
4NLW 2.1 Å, Poliovirus Polymerase - G289A/C290I Loop Mutant
1HXS 2.2 Å, Crystal structure of mahoney strain of poliovirus at 2.2A resolution
4NLO 2.2 Å, Poliovirus Polymerase - C290I Loop Mutant
4NLP 2.2 Å, Poliovirus Polymerase - C290V Loop Mutant
2IM0 2.25 Å, Crystal structure of poliovirus polymerase complexed with CTP and Mg2+
1TQL 2.3 Å, Poliovirus polymerase G1A mutant

Browse structure collections

About this viewer

MolViewer shows 1L1N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.