1L3K: Heterogeneous nuclear ribonucleoprotein A1

UP1, the two RNA-recognition motif domain of hnrnp A1. Determined by X-ray diffraction at 1.1 Å resolution. Released 17 Apr 2002.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,624
Mol. weight: 22.3 kDa
Released: 17 Apr 2002

Explore 1L3K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1L3K contains 9 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	11-14	4
β-strand	15-19	5	1
α-helix	27-34	8
α-helix	35-37	3
β-strand	40-47	8	1
β-strand	54-62	9	1
α-helix	65-73	9
α-helix	75	1
α-helix	77	1
β-strand	78-79	2	2
β-strand	82-83	2	2
β-strand	85-88	4	1
α-helix	89-90	2
β-strand	106-110	5	3
α-helix	118-125	8
β-strand	131-138	8	3
β-strand	145-153	9	3
α-helix	156-164	9
β-strand	169-170	2	4
β-strand	173-174	2	4
β-strand	176-179	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterogeneous nuclear ribonucleoprotein A1	A	protein	196	Homo sapiens	P09651 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1L3K_1 HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A1 (chains A)
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LSKQEMASASSSQRGR

Primary citation

Correlated alternative side chain conformations in the RNA-recognition motif of heterogeneous nuclear ribonucleoprotein A1. Vitali, J., Ding, J., Jiang, J. et al. Nucleic Acids Res (2002) 30:1531-1538. DOI 10.1093/nar/30.7.1531 · PubMed

Other PDB entries of the same protein (UniProt P09651 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZGL 0.95 Å, hnRNP A1 segment GGGYGGS (residues 234-240)
6J60 0.96 Å, hnRNP A1 reversible amyloid core GFGGNDNFG (residues 209-217)
6BXX 1.1 Å, GYNGFG from low-complexity domain of hnRNPA1, residues 243-248
9F4G 1.4 Å, UP1 in complex with Z1373445602
9F4H 1.4 Å, UP1 in complex with Z106579662
9F4J 1.4 Å, UP1 in complex with Z416341642
9F4L 1.4 Å, UP1 in complex with Z104584152
9F4N 1.4 Å, UP1 in complex with Z137811222
9F4O 1.4 Å, UP1 in complex with Z991506900
9F4P 1.4 Å, UP1 in complex with Z1217960891
9F4Q 1.4 Å, UP1 in complex with Z641239276
9F4S 1.4 Å, UP1 in complex with Z56880342

Browse structure collections

About this viewer

MolViewer shows 1L3K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.