1LGV: Immunoglobulin lambda light chain

Structure of a Human Bence-Jones Dimer Crystallized in U.S. Space Shuttle Mission STS-95: 100K. Determined by X-ray diffraction at 1.95 Å resolution. Released 1 Jul 2003.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,415
Mol. weight: 45.22 kDa
Released: 1 Jul 2003

Explore 1LGV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LGV contains 15 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	5	1	2
β-strand	9-12	4	3
β-strand	18-23	6	2
β-strand	35-40	6	3
β-strand	47-50	4	3
β-strand	51	1	4
β-strand	55	1	4
β-strand	64-69	6	2
β-strand	72-77	6	2
α-helix	82-84	3
β-strand	86-93	8	3
β-strand	100-102	3	3
β-strand	103	1	1
β-strand	106-110	5	3
α-helix	113-115	3
β-strand	116	1	5
α-helix	117-118	2
β-strand	119-123	5	6
α-helix	124-126	3
α-helix	127-131	5
β-strand	135-144	10	6
β-strand	145	1	5
β-strand	150-155	6	7
β-strand	158-159	2	7
α-helix	160	1
β-strand	164-166	3	6
α-helix	167-169	3
β-strand	170-171	2	6
β-strand	177-185	9	6
α-helix	187-191	5
β-strand	196-202	7	7
β-strand	205-211	7	7

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	8
β-strand	9-12	4	9
β-strand	18-23	6	8
α-helix	25-27	3
β-strand	35-40	6	9
α-helix	45-46	2
β-strand	47-50	4	9
β-strand	51	1	10
β-strand	55	1	10
β-strand	64-69	6	8
β-strand	72-77	6	8
α-helix	82-84	3
β-strand	86-94	9	9
β-strand	99-102	4	9
β-strand	106-110	5	9
β-strand	116	1	11
α-helix	117-118	2
β-strand	119-123	5	12
α-helix	124-126	3
α-helix	127-131	5
β-strand	135-144	10	12
β-strand	145	1	11
β-strand	150-155	6	13
β-strand	158-159	2	13
β-strand	164-166	3	12
β-strand	170-171	2	12
β-strand	177-185	9	12
α-helix	187-192	6
β-strand	196-202	7	13
β-strand	205-211	7	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin lambda light chain	A, B	protein	216	Homo sapiens	Q6PJG0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1LGV_1 IMMUNOGLOBULIN LAMBDA LIGHT CHAIN (chains A, B)
QTALTQPASVSGSPGQSITVSCTGVSSIVGSYNLVSWYQQHPGKAPKLLTYEVNKRPSGV
SDRFSGSKSGNSASLTISGLQAEDEADYYCSSYDGSSTSVVFGGGTKLTVLGQPKAAPSV
TLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTKPSKQSNNKYAAS
SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTAC

Primary citation

Comparison of the three-dimensional structures of a human Bence-Jones dimer crystallized on Earth and aboard US Space Shuttle Mission STS-95. Terzyan, S.S., DeWitt, C.R., Ramsland, P.A. et al. J Mol Recognit (2003) 16:83-90. DOI 10.1002/jmr.610 · PubMed

Other PDB entries of the same protein (UniProt Q6PJG0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1JVK 1.94 Å, Three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal…
1LHZ 2.3 Å, Structure of a Human Bence-Jones Dimer Crystallized in U.S. Space Shuttle Mission…
6CBJ 2.85 Å, Crystal Structure of DH270.3 Fab in complex with Man9
8FK5 3.4 Å, Cryo-EM Structure of PG9RSH DU011 Fab in complex with BG505 DS-SOSIP.664

Browse structure collections

About this viewer

MolViewer shows 1LGV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.