1LJ2: Nonstructural RNA-binding protein 34

Recognition of eIF4G by Rotavirus NSP3 reveals a basis for mRNA circularization. Determined by X-ray diffraction at 2.38 Å resolution. Released 5 Jul 2002.

Method: X-ray diffraction
Resolution: 2.38 Å
Organism: Simian rotavirus A/SA11
Chains: 4
Atoms: 2,327
Mol. weight: 32.68 kDa
Ligands: AU
Released: 5 Jul 2002

Explore 1LJ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LJ2 contains 10 α-helices and 5 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	209-211	3
α-helix	212-250	39
α-helix	256-266	11
α-helix	274-303	30
β-strand	309-311	3	1

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	209-250	42
α-helix	256-267	12
α-helix	274-306	33
β-strand	309-314	6	2

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	141-143	3	1
α-helix	145-147	3
α-helix	153-156	4

Chain D: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	138-144	7	2
β-strand	150-151	2	2
α-helix	153-157	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nonstructural RNA-binding protein 34	A, B	protein	110	Simian rotavirus A/SA11	P03536
eukaryotic protein synthesis initiation factor	C, D	protein	28		Q04637 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1LJ2_1 NONSTRUCTURAL RNA-BINDING PROTEIN 34 (chains A, B)
MHSLQNVIPQQQAHIAELQVYNNKLERDLQNKIGSLTSSIEWYLRSMELDPEIKADIEQQ
INSIDAINPLHAFDDLESVIRNLISDYDKLFLMFKGLIQRSNYQYSFGSE

Sequence of entity 2 (C, D), FASTA

>1LJ2_2 eukaryotic protein synthesis initiation factor (chains C, D)
APKRERKTIRIRDPNQGGKDITEEIMSG

Ligands and cofactors

ID	Name	Formula	Copies
AU	Gold ion	Au	3

Primary citation

Recognition of eIF4G by rotavirus NSP3 reveals a basis for mRNA circularization. Groft, C.M., Burley, S.K. Mol Cell (2002) 9:1273-1283. DOI 10.1016/S1097-2765(02)00555-5 · PubMed

Other PDB entries of the same protein (UniProt P03536), best resolution first:

1KNZ 2.45 Å, Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer

Browse structure collections

About this viewer

MolViewer shows 1LJ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.