1LKJ: Calmodulin

NMR Structure of Apo Calmodulin from Yeast Saccharomyces cerevisiae. Determined by solution NMR. Released 29 Apr 2003.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,122
Mol. weight: 16.02 kDa
Released: 29 Apr 2003

Explore 1LKJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LKJ contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-28	3	1
α-helix	29-39	11
α-helix	45-55	11
β-strand	62-64	3	1
α-helix	65-75	11
α-helix	81-92	12
β-strand	99-101	3	2
α-helix	102-112	11
α-helix	118-128	11
β-strand	134-136	3	2
α-helix	137-144	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	146	Saccharomyces cerevisiae	P06787 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1LKJ_1 Calmodulin (chains A)
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGN
HQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAE
VDDMLREVSDGSGEINIQQFAALLSK

Primary citation

The solution structure of apocalmodulin from Saccharomyces cerevisiae implies a mechanism for its unique Ca2+ binding property. Ishida, H., Nakashima, K., Kumaki, Y. et al. Biochemistry (2002) 41:15536-15542. DOI 10.1021/bi020330r · PubMed

Other PDB entries of the same protein (UniProt P06787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OQQ 2.1 Å, Legionella pneumophila SidJ/Saccharomyces cerevisiae calmodulin complex
1F54 Solution structure of the apo N-terminal domain of yeast calmodulin
1F55 Solution structure of the calcium bound N-terminal domain of yeast calmodulin
2LHH Solution structure of Ca2+-bound yCaM
2LHI Solution structure of Ca2+/CNA1 peptide-bound yCaM

Browse structure collections

About this viewer

MolViewer shows 1LKJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.