1LQV: Endothelial protein C receptor

Crystal structure of the Endothelial protein C receptor with phospholipid in the groove in complex with Gla domain of protein C. Determined by X-ray diffraction at 1.6 Å resolution. Released 19 Jun 2002.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,048
Mol. weight: 56.17 kDa
Ligands: NAG, PTY, CA
Released: 19 Jun 2002

Explore 1LQV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LQV contains 25 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9-21	13	1
β-strand	24-33	10	1
β-strand	36-44	9	1
β-strand	49-52	4	1
α-helix	59-87	29
β-strand	93-103	11	1
α-helix	109-110	2
β-strand	111-118	8	1
β-strand	121-127	7	1
β-strand	132-135	4	1
α-helix	142-151	10
α-helix	156-160	5
α-helix	161-163	3
α-helix	164-168	5
α-helix	169-176	8

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-21	12	2
β-strand	24-33	10	2
β-strand	36-43	8	2
β-strand	49-52	4	2
α-helix	59-87	29
β-strand	93-102	10	2
α-helix	109-110	2
β-strand	111-118	8	2
β-strand	121-127	7	2
β-strand	132-135	4	2
α-helix	142-151	10
α-helix	156-160	5
α-helix	161-163	3
α-helix	164-169	6
α-helix	170-176	7
α-helix	177-179	3

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	6-8	3
α-helix	10-11	2
α-helix	13	1
α-helix	14-18	5
α-helix	24-31	8

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	6-8	3
α-helix	10-11	2
α-helix	13	1
α-helix	14-18	5
α-helix	24-32	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelial protein C receptor	A, B	protein	193	Homo sapiens	Q9UNN8 (AlphaFold model)
Vitamin-K dependent protein C	C, D	protein	33	Homo sapiens	P04070 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1LQV_1 Endothelial protein C receptor (chains A, B)
SQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPE
SWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNG
SSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAE
NTKGSQTSRSYTS

Sequence of entity 2 (C, D), FASTA

>1LQV_2 Vitamin-K dependent protein C (chains C, D)
ANSFLEELRHSSLERECIEEICDFEEAKEIFQN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6
PTY	Phosphatidylethanolamine	C40 H80 N O8 P	2
CA	Calcium ion	Ca	14

Primary citation

The crystal structure of the endothelial protein C receptor and a bound phospholipid. Oganesyan, V., Oganesyan, N., Terzyan, S. et al. J Biol Chem (2002) 277:24851-24854. DOI 10.1074/jbc.C200163200 · PubMed

Other PDB entries of the same protein (UniProt Q9UNN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JTC 1.6 Å, Importance of Mg2+ in the Ca2+-Dependent Folding of the gamma-Carboxyglutamic Acid…
7Q5D 1.8 Å, Structure of EPCR in a non-canonical conformation
7OKV 1.85 Å, Crystal structure of soluble EPCR after exposure to the nonionic surfactant Polysorbate 20
7OKS 1.95 Å, X-ray structure of soluble EPCR in P212121 space group
7OKT 1.95 Å, X-ray structure of soluble EPCR in C2221 space group
7OKU 1.95 Å, X-ray structure of soluble EPCR in P3121 space group
1L8J 2.0 Å, Crystal Structure of the Endothelial Protein C Receptor and Bound Phospholipid Molecule
4V3D 2.65 Å, The CIDRa domain from HB3var03 PfEMP1 bound to endothelial protein C receptor
4V3E 2.9 Å, The CIDRa domain from IT4var07 PfEMP1 bound to endothelial protein C receptor
9TJX 3.0 Å, Structure of factor VII Gla domain bound to EPCR
6SNY 3.11 Å, Synthetic mimic of an EPCR-binding PfEMP1 bound to EPCR
8C44 3.2 Å, HB3VAR03 apo headstructure (PfEMP1 A) complexed with EPCR

Browse structure collections

About this viewer

MolViewer shows 1LQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.