Structural Studies of Bacteriophage alpha3 Assembly, X-Ray Crystallography. Determined by X-ray diffraction at 3.5 Å resolution. Released 25 Dec 2002.
Explore 1M06 in 3D Show helices and sheets RCSB PDB PDBe
1M06 contains 28 α-helices and 40 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-14 | 4 | 1 |
| β-strand | 17-23 | 7 | 1 |
| β-strand | 27-28 | 2 | 2 |
| β-strand | 29-36 | 8 | 3 |
| β-strand | 41-52 | 12 | 1 |
| α-helix | 53-54 | 2 | |
| β-strand | 55 | 1 | 4 |
| β-strand | 63-73 | 11 | 3 |
| α-helix | 74-78 | 5 | |
| α-helix | 80-88 | 9 | |
| α-helix | 89-91 | 3 | |
| α-helix | 95-96 | 2 | |
| β-strand | 97-99 | 3 | 5 |
| α-helix | 108-110 | 3 | |
| β-strand | 119-121 | 3 | 5 |
| α-helix | 122-131 | 10 | |
| α-helix | 132-136 | 5 | |
| α-helix | 142-144 | 3 | |
| α-helix | 149-151 | 3 | |
| α-helix | 154-159 | 6 | |
| β-strand | 161-162 | 2 | 2 |
| β-strand | 164 | 1 | 6 |
| α-helix | 165-167 | 3 | |
| β-strand | 174 | 1 | 7 |
| α-helix | 193-212 | 20 | |
| α-helix | 216-222 | 7 | |
| α-helix | 234-235 | 2 | |
| β-strand | 236-245 | 10 | 3 |
| β-strand | 247-251 | 5 | 8 |
| β-strand | 261-265 | 5 | 8 |
| β-strand | 266-277 | 12 | 1 |
| β-strand | 282-291 | 10 | 3 |
| β-strand | 299 | 1 | 9 |
| α-helix | 302-305 | 4 | |
| α-helix | 311-314 | 4 | |
| α-helix | 318-321 | 4 | |
| α-helix | 325-326 | 2 | |
| β-strand | 327-330 | 4 | 7 |
| α-helix | 331-333 | 3 | |
| β-strand | 335 | 1 | 9 |
| β-strand | 343-346 | 4 | 7 |
| α-helix | 350-352 | 3 | |
| α-helix | 361-365 | 5 | |
| α-helix | 384-388 | 5 | |
| β-strand | 389 | 1 | 6 |
| α-helix | 392-398 | 7 | |
| β-strand | 399 | 1 | 4 |
| β-strand | 403 | 1 | 10 |
| β-strand | 405 | 1 | 10 |
| β-strand | 407-419 | 13 | 1 |
| α-helix | 424-428 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-24 | 8 | 11 |
| β-strand | 27 | 1 | 12 |
| β-strand | 32-34 | 3 | 13 |
| β-strand | 35 | 1 | 12 |
| β-strand | 45-54 | 10 | 11 |
| β-strand | 62-69 | 8 | 12 |
| α-helix | 70-71 | 2 | |
| β-strand | 78-89 | 12 | 11 |
| β-strand | 96-104 | 9 | 12 |
| β-strand | 111-113 | 3 | 13 |
| α-helix | 114-116 | 3 | |
| β-strand | 118-120 | 3 | 12 |
| β-strand | 126-127 | 2 | 11 |
| β-strand | 131-141 | 11 | 11 |
| β-strand | 150-159 | 10 | 12 |
| β-strand | 165-175 | 11 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-5 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Capsid Protein | F | protein | 431 | Enterobacteria phage alpha3 | P08767 |
| Major spike protein | G | protein | 187 | Enterobacteria phage alpha3 | P31281 |
| Small core protein | J | protein | 24 | Enterobacteria phage alpha3 | P69548 (AlphaFold model) |
| 5'-D(P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR))-3' | X | DNA | 10 | Enterobacteria phage alpha3 |
>1M06_1 Capsid Protein (chains F) MSNVQTSAEREIVDLSHLAFDCGMLGRLKTVSWTPVIAGDSFELDAVGALRLSPLRRGLA IDSKVDFFTFYIPHRHVYGDQWIQFMRDGVNAQPLPSVTCNRYPDHAGYVGTIVPANNRI PKFLHQSYLNIYNNYFRAPWMPERTEANPSNLNEDDARYGFRCCHLKNIWSAPLPPETKL AEEMGIESNSIDIMGLQAAYAQLHTEQERTYFMQRYRDVISSFGGSTSYDADNRPLLVMH TDFWASGYDVDGTDQSSLGQFSGRVQQTFKHSVPRFFVPEHGVMMTLALIRFPPISPLEH HYLAGKSQLTYTDLAGDPALIGNLPPREISYRDLFRDGRSGIKIKVAESIWYRTHPDYVN FKYHDLHGFPFLDDAPGTSTGDNLQEAILVRHQDYDACFQSQQLLQWNKQARYNVSVYRH MPTVRDSIMTS
>1M06_2 Major spike protein (chains G) MYQNFVTKHDTAIQTSRFSVTGNVIPAAPTGNIPVINGGSITAERAVVNLYANMNVSTSS DGSFIVAMKVDTSPTDPNCVISAGVNLSFAGTSYPIVGIVRFESASEQPTSIAGSEVEHY PIEMSVGSGGVCSARDCATVDIHPRTSGNNVFVGVICSSAKWTSGRVIGTIATTQVIHEY QVLQPLK
>1M06_3 Small core protein (chains J) MKKARRSPSRRKGARLWYVGGSQF
>1M06_4 5'-D(P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR)P*(3DR))-3' (chains X) NNNNNNNNNN
Structural Studies of Bacteriophage alpha3 Assembly. Bernal, R.A., Hafenstein, S., Olson, N.H. et al. J Mol Biol (2003) 325:11-24. DOI 10.1016/S0022-2836(02)01201-9 · PubMed
Other PDB entries of the same protein (UniProt P08767), best resolution first:
MolViewer shows 1M06 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.