1M0M: Bacteriorhodopsin M1 intermediate

Bacteriorhodopsin M1 intermediate at 1.43 a resolution. Determined by X-ray diffraction at 1.43 Å resolution. Released 11 Sept 2002.

Method: X-ray diffraction
Resolution: 1.43 Å
Organism: Halobacterium salinarum
Chains: 1
Atoms: 2,073
Mol. weight: 37.24 kDa
Ligands: SQU, LI1, RET
Released: 11 Sept 2002

Explore 1M0M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M0M contains 10 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-30	21
α-helix	37-62	26
β-strand	67-71	5	1
β-strand	74-78	5	1
α-helix	81-100	20
α-helix	105-127	23
α-helix	131-154	24
α-helix	165-191	27
α-helix	201-213	13
α-helix	214-218	5
α-helix	219-225	7
α-helix	227-229	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bacteriorhodopsin	A	protein	262	Halobacterium salinarum	P02945 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1M0M_1 BACTERIORHODOPSIN (chains A)
MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITT
LVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGT
ILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEV
ASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSR
AIFGEAEAPEPSAGDGAAATSD

Ligands and cofactors

ID	Name	Formula	Copies
SQU	2,10,23-trimethyl-tetracosane	C27 H56	1
LI1	1-[2,6,10.14-tetramethyl-hexadecan-16-yl]-2-[2,10,14-trimethylhexadecan-16-yl]g…	C42 H86 O3	13
RET	Retinal	C20 H28 O	1

Primary citation

Crystallographic structure of the retinal and the protein after deprotonation of the Schiff base: the switch in the bacteriorhodopsin photocycle. Lanyi, J., Schobert, B. J Mol Biol (2002) 321:727-737. DOI 10.1016/S0022-2836(02)00682-4 · PubMed

Other PDB entries of the same protein (UniProt P02945 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z09 1.05 Å, Crystal structure of the ground state of bacteriorhodopsin at 1.05 Angstrom resolution
7Z0D 1.2 Å, Crystal structure of the L state of bacteriorhodopsin at 1.20 Angstrom resolution
7Z0A 1.22 Å, Crystal structure of the ground state of bacteriorhodopsin at 1.22 Angstrom resolution
7Z0E 1.22 Å, Crystal structure of the M state of bacteriorhodopsin at 1.22 Angstrom resolution
5ZIM 1.25 Å, Crystal structure of bacteriorhodopsin at 1.25 A resolution
5ZIN 1.27 Å, Crystal structure of bacteriorhodopsin at 1.27 A resolution
5ZIL 1.29 Å, Crystal structure of bacteriorhodopsin at 1.29 A resolution
7XJC 1.33 Å, Crystal structure of bacteriorhodopsin in the ground and K states after green laser…
7XJD 1.33 Å, Crystal structure of bacteriorhodopsin in the ground state by red laser irradiation
7XJE 1.33 Å, Crystal structure of bacteriorhodopsin in the K state refined against the extrapolated…
1M0K 1.43 Å, Bacteriorhodopsin K intermediate at 1.43 a resolution
9F9G 1.44 Å, Laser excitation effects on BR: Reprocessed Dark from Nogly et al.

Browse structure collections

About this viewer

MolViewer shows 1M0M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.