1MCO: Human immunoglobulin with a hinge deletion

Name: PDB 1MCO: Three-dimensional structure of a human immunoglobulin with a hinge deletion
Published: 1994-01-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: immunoglobulin

Three-dimensional structure of a human immunoglobulin with a hinge deletion. Determined by X-ray diffraction at 3.2 Å resolution. Released 31 Jan 1994.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,041
Mol. weight: 71.65 kDa
Released: 31 Jan 1994

Explore 1MCO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MCO contains 10 α-helices and 67 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	9
β-strand	10-11	2	10
β-strand	19-24	6	9
β-strand	36-40	5	11
β-strand	43	1	12
β-strand	45	1	12
β-strand	48-53	6	11
β-strand	60-61	2	11
β-strand	71-74	4	9
β-strand	79-83	5	9
β-strand	94-95	2	13
β-strand	97-99	3	11
β-strand	111-112	2	13
β-strand	113-114	2	10
β-strand	117	1	10
β-strand	124-126	3	14
α-helix	134-135	2
β-strand	141-147	7	14
β-strand	155-158	4	15
β-strand	167-170	4	14
α-helix	171-172	2
β-strand	173	1	8
β-strand	181-187	7	14
β-strand	200-203	4	15
β-strand	211-213	3	15
β-strand	224-228	5	16
α-helix	229-231	3
α-helix	232-236	5
β-strand	245-249	5	16
β-strand	259	1	17
β-strand	262-264	3	18
β-strand	268	1	18
β-strand	278-281	4	16
β-strand	284-290	7	16
α-helix	296-299	4
β-strand	304-308	5	18
β-strand	309	1	17
β-strand	317-321	5	18
β-strand	332-336	5	19
α-helix	340-342	3
β-strand	349-355	7	19
β-strand	364	1	20
β-strand	378	1	19
β-strand	382-383	2	21
β-strand	389-390	2	21
β-strand	391-396	6	19
α-helix	399-402	4
β-strand	408-412	5	20
β-strand	422-426	5	20

Chain L: 3 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	9-12	4	2
β-strand	17-23	7	1
β-strand	35	1	3
β-strand	37-40	4	2
β-strand	42	1	4
β-strand	44	1	4
β-strand	47-50	4	2
β-strand	51	1	5
β-strand	55	1	5
β-strand	64-69	6	1
β-strand	72-78	7	1
β-strand	87-89	3	2
β-strand	91-95	5	3
β-strand	98-101	4	3
β-strand	105-109	5	2
β-strand	119-122	4	6
α-helix	126-129	4
β-strand	134-143	10	6
β-strand	149-153	5	7
β-strand	158	1	7
α-helix	159	1
β-strand	163-166	4	6
β-strand	171	1	8
β-strand	176-184	9	6
α-helix	186-191	6
β-strand	196-201	6	7
β-strand	204-205	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgG1 mcg intact antibody (light chain)	L	protein	216	Homo sapiens
IgG1 mcg intact antibody (heavy chain)	H	protein	428	Homo sapiens

Sequence of entity 1 (L), FASTA

>1MCO_1 IGG1 MCG INTACT ANTIBODY (LIGHT CHAIN) (chains L)
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGV
PDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVT
LFPPSSEELQANKATEVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 2 (H), FASTA

>1MCO_2 IGG1 MCG INTACT ANTIBODY (HEAVY CHAIN) (chains H)
PLVLQESGPGLVKPSEALSLTCTVSGDSINTILYYWSWIRQPPGKGLEWIGYIYYSGSTY
GNPSLKSRVTISVNTSKNQFYSKLSSVTAADTAVYYCARVPLVVNPWGQGTLVTVSSAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLD
GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH
YTQKSLSL

Primary citation

Three-dimensional structure of a human immunoglobulin with a hinge deletion. Guddat, L.W., Herron, J.N., Edmundson, A.B. Proc Natl Acad Sci U S A (1993) 90:4271-4275. DOI 10.1073/pnas.90.9.4271 · PubMed

Browse more

1MCO is part of these collections:

Antibodies and the immune system

About this viewer

MolViewer shows 1MCO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.