The complex between the subtilisin from a mesophilic bacterium and the leech inhibitor eglin-C. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Oct 1992.
Explore 1MEE in 3D Show helices and sheets RCSB PDB PDBe
1MEE contains 13 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-10 | 5 | |
| α-helix | 13-19 | 7 | |
| β-strand | 27-32 | 6 | 1 |
| β-strand | 44-49 | 6 | 1 |
| β-strand | 51 | 1 | 2 |
| β-strand | 54 | 1 | 2 |
| α-helix | 65-73 | 9 | |
| β-strand | 89-94 | 6 | 1 |
| β-strand | 101 | 1 | 3 |
| α-helix | 104-116 | 13 | |
| β-strand | 121-124 | 4 | 1 |
| β-strand | 126-127 | 2 | 3 |
| β-strand | 128 | 1 | 4 |
| α-helix | 133-144 | 12 | |
| β-strand | 148-152 | 5 | 1 |
| β-strand | 159 | 1 | 5 |
| β-strand | 162 | 1 | 5 |
| β-strand | 167 | 1 | 4 |
| β-strand | 175-180 | 6 | 1 |
| β-strand | 186 | 1 | 1 |
| β-strand | 198-201 | 4 | 1 |
| β-strand | 205-209 | 5 | 6 |
| β-strand | 213-217 | 5 | 6 |
| α-helix | 220-237 | 18 | |
| α-helix | 243-252 | 10 | |
| α-helix | 254 | 1 | |
| β-strand | 255 | 1 | 1 |
| α-helix | 256 | 1 | |
| α-helix | 260-263 | 4 | |
| β-strand | 267 | 1 | 1 |
| α-helix | 270-273 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9 | 1 | 7 |
| α-helix | 11-13 | 3 | |
| β-strand | 14 | 1 | 8 |
| β-strand | 16 | 1 | 8 |
| β-strand | 17 | 1 | 7 |
| α-helix | 18-28 | 11 | |
| β-strand | 33-38 | 6 | 7 |
| β-strand | 43-44 | 2 | 3 |
| β-strand | 51-57 | 7 | 7 |
| β-strand | 62-63 | 2 | 7 |
| β-strand | 68-69 | 2 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mesentericopeptidase | A | protein | 275 | Bacillus pumilus | P07518 (AlphaFold model) |
| Eglin C | I | protein | 64 | Hirudo medicinalis | P01051 (AlphaFold model) |
>1MEE_1 MESENTERICOPEPTIDASE (chains A) AQSVPYGISQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQD GSSHGTHVAGTIAALNNSIGVLGVAPSASLYAVKVLDSTGSGQYSWIINGIEWAISNNMD VINMSLGGPTGSTALKTVVDKAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAV NSANQRASFSSAGSELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPT WTNAQVRDRLESTATYLGSSFYYGKGLINVQAAAQ
>1MEE_2 EGLIN C (chains I) LKSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHV PHVG
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Complex between the subtilisin from a mesophilic bacterium and the leech inhibitor eglin-C. Dauter, Z., Betzel, C., Genov, N. et al. Acta Crystallogr B (1991) 47:707-730. DOI 10.1107/S0108768191004202 · PubMed
MolViewer shows 1MEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.