1MF2: Anti HIV1 protease FAB complex

Anti HIV1 protease FAB complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 31 Dec 1997.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,857
Mol. weight: 95.94 kDa
Released: 31 Dec 1997

Explore 1MF2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MF2 contains 22 α-helices and 93 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	10-12	3	9
β-strand	18-25	8	8
α-helix	29-31	3
β-strand	33-40	8	9
β-strand	44-51	8	9
β-strand	57-59	3	9
β-strand	68-72	5	8
α-helix	73-75	3
β-strand	77-82	6	8
α-helix	84-86	3
β-strand	88-98	11	9
α-helix	100D	1
β-strand	100E-103	7	9
β-strand	107-111	5	9
α-helix	114-116	3
β-strand	117	1	10
β-strand	120-124	5	11
β-strand	130-140	11	11
β-strand	141	1	10
β-strand	146-149	4	12
α-helix	150-152	3
β-strand	154	1	12
β-strand	158-160	3	11
α-helix	161-163	3
β-strand	164-165	2	11
β-strand	170-179	10	11
α-helix	182-185	4
β-strand	189-194	6	12
α-helix	195-197	3
β-strand	199-204	6	12

Chain L: 3 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10	1	2
β-strand	13	1	3
β-strand	19-25	7	1
β-strand	27C-27D	2	4
β-strand	30-31	2	4
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
β-strand	62-67	6	1
β-strand	70-75	6	1
β-strand	84-90	7	2
β-strand	97-98	2	2
β-strand	102-104	3	2
β-strand	106	1	3
β-strand	111	1	5
β-strand	114-118	5	6
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	6
β-strand	140	1	5
β-strand	145-150	6	7
β-strand	153-154	2	7
β-strand	159-163	5	6
β-strand	173-182	10	6
α-helix	183-186	4
β-strand	191-197	7	7
β-strand	205-210	6	7

Chain M: 4 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	13
β-strand	10	1	14
β-strand	13	1	15
β-strand	19-25	7	13
β-strand	27C-27D	2	16
β-strand	30-31	2	16
β-strand	33-38	6	14
β-strand	45-49	5	14
β-strand	53-54	2	14
β-strand	62-67	6	13
β-strand	70-75	6	13
β-strand	84-90	7	14
β-strand	97-98	2	14
β-strand	102-104	3	14
β-strand	106	1	15
β-strand	111	1	17
β-strand	114-118	5	18
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	18
β-strand	140	1	17
β-strand	144-150	7	19
β-strand	153-154	2	19
β-strand	159-164	6	18
α-helix	165-167	3
β-strand	173-182	10	18
α-helix	183-186	4
β-strand	191-198	8	19
β-strand	205-210	6	19

Chain N: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	20
β-strand	10-12	3	21
β-strand	18-25	8	20
α-helix	29-31	3
β-strand	33-40	8	21
β-strand	44-51	8	21
β-strand	57-59	3	21
β-strand	68-72	5	20
β-strand	77-82	6	20
α-helix	84-86	3
β-strand	88-98	11	21
β-strand	100E-103	7	21
β-strand	107-111	5	21
α-helix	115-116	2
β-strand	117	1	22
β-strand	120-124	5	23
β-strand	130-140	11	23
β-strand	141	1	22
β-strand	146-149	4	24
α-helix	150-152	3
β-strand	158-160	3	23
α-helix	161-163	3
β-strand	164-166	3	23
β-strand	169-179	11	23
β-strand	189-194	6	24
α-helix	195-197	3
β-strand	199-204	6	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monoclonal antibody F11.2.32	L, M	protein	215	Mus musculus	P01654 (AlphaFold model)
Monoclonal antibody F11.2.32	H, N	protein	226	Mus musculus	P01868 (AlphaFold model)

Sequence of entity 1 (L, M), FASTA

>1MF2_1 MONOCLONAL ANTIBODY F11.2.32 (chains L, M)
DTVLTQSPASLAVSLGQRATISCRASESVDYYGKSFMNWFQQKPGQPPKLLIYAASNQGS
GVPARFSGSGSGTDFSLHIHPMEEDDSAMYFCQQSKEVPWTFGGGTKLEIKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Sequence of entity 2 (H, N), FASTA

>1MF2_2 MONOCLONAL ANTIBODY F11.2.32 (chains H, N)
DVQLVESGGGLVQPGGSRKLSCAASGFTFMRFGMHWVRQAPEKGLEWVAYISSGSSTIYY
ADTVKGRFTISRDNPKNTLFLQMTSLRSEDTALYYCARSGGIERYDGTYYVMDYWGQGTS
VTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPA
VLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD

Primary citation

Three-dimensional structure of an Fab-peptide complex: structural basis of HIV-1 protease inhibition by a monoclonal antibody. Lescar, J., Stouracova, R., Riottot, M.M. et al. J Mol Biol (1997) 267:1207-1222. DOI 10.1006/jmbi.1997.0950 · PubMed

Other PDB entries of the same protein (UniProt P01654 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ORB 2.2 Å, The structure of the anti-c-myc antibody 9E10 Fab fragment
2OR9 2.7 Å, The structure of the anti-c-myc antibody 9E10 Fab fragment/epitope peptide complex…

Browse structure collections

About this viewer

MolViewer shows 1MF2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.