Model of MHC class I H2-M3 with nonapeptide from rat ND1 refined at 2.3 Å resolution. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 Jan 1996.
Explore 1MHC in 3D Show helices and sheets RCSB PDB PDBe
1MHC contains 25 α-helices and 60 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-12 | 10 | 1 |
| β-strand | 22-28 | 7 | 1 |
| β-strand | 31-39 | 9 | 1 |
| β-strand | 42-47 | 6 | 1 |
| α-helix | 50-52 | 3 | |
| α-helix | 58-84 | 27 | |
| β-strand | 94-103 | 10 | 1 |
| β-strand | 109-118 | 10 | 1 |
| β-strand | 121-126 | 6 | 1 |
| β-strand | 133-135 | 3 | 1 |
| α-helix | 138-150 | 13 | |
| α-helix | 153-159 | 7 | |
| α-helix | 160-164 | 5 | |
| α-helix | 165-174 | 10 | |
| α-helix | 176-179 | 4 | |
| β-strand | 183 | 1 | 2 |
| α-helix | 184-185 | 2 | |
| β-strand | 186-193 | 8 | 3 |
| β-strand | 199-208 | 10 | 3 |
| β-strand | 209 | 1 | 2 |
| β-strand | 214-219 | 6 | 4 |
| β-strand | 222-223 | 2 | 4 |
| β-strand | 229-230 | 2 | 3 |
| α-helix | 231-233 | 3 | |
| β-strand | 234-235 | 2 | 3 |
| β-strand | 241-249 | 9 | 3 |
| α-helix | 254-256 | 3 | |
| β-strand | 257-262 | 6 | 4 |
| β-strand | 270-272 | 3 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 5 |
| α-helix | 4-5 | 2 | |
| β-strand | 6-11 | 6 | 6 |
| β-strand | 21-30 | 10 | 6 |
| β-strand | 31 | 1 | 5 |
| β-strand | 35-41 | 7 | 7 |
| β-strand | 44-45 | 2 | 7 |
| β-strand | 50-51 | 2 | 6 |
| α-helix | 52-54 | 3 | |
| β-strand | 55-56 | 2 | 6 |
| β-strand | 62-70 | 9 | 6 |
| β-strand | 78-84 | 7 | 7 |
| β-strand | 91-94 | 4 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-12 | 10 | 8 |
| β-strand | 22-28 | 7 | 8 |
| β-strand | 31-39 | 9 | 8 |
| β-strand | 42-47 | 6 | 8 |
| α-helix | 50-54 | 5 | |
| α-helix | 57-84 | 28 | |
| α-helix | 87-88 | 2 | |
| β-strand | 94-103 | 10 | 8 |
| β-strand | 109-118 | 10 | 8 |
| β-strand | 121-126 | 6 | 8 |
| β-strand | 133-135 | 3 | 8 |
| α-helix | 138-150 | 13 | |
| α-helix | 152-159 | 8 | |
| α-helix | 160-164 | 5 | |
| α-helix | 165-174 | 10 | |
| α-helix | 176-179 | 4 | |
| β-strand | 183 | 1 | 9 |
| α-helix | 184-185 | 2 | |
| β-strand | 186-193 | 8 | 10 |
| β-strand | 199-208 | 10 | 10 |
| β-strand | 209 | 1 | 9 |
| β-strand | 214-219 | 6 | 11 |
| β-strand | 222-223 | 2 | 11 |
| β-strand | 229-230 | 2 | 10 |
| α-helix | 231-233 | 3 | |
| β-strand | 234-235 | 2 | 10 |
| β-strand | 241-249 | 9 | 10 |
| α-helix | 253-256 | 4 | |
| β-strand | 257-262 | 6 | 11 |
| β-strand | 270-272 | 3 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 12 |
| α-helix | 4-5 | 2 | |
| β-strand | 6-11 | 6 | 13 |
| β-strand | 21-30 | 10 | 13 |
| β-strand | 31 | 1 | 12 |
| β-strand | 35-41 | 7 | 14 |
| β-strand | 44-45 | 2 | 14 |
| α-helix | 46 | 1 | |
| β-strand | 50-51 | 2 | 13 |
| β-strand | 55-56 | 2 | 13 |
| β-strand | 62-70 | 9 | 13 |
| β-strand | 78-84 | 7 | 14 |
| β-strand | 91-94 | 4 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MHC class I antigen H2-M3 | A, D | protein | 282 | Mus musculus | Q31093 (AlphaFold model) |
| MHC class I antigen H2-M3 | B, E | protein | 99 | Mus musculus | P01887 (AlphaFold model) |
| Nonapeptide from rat NADH dehydrogenase | C, F | protein | 9 | Rattus rattus | P03889 (AlphaFold model) |
>1MHC_1 MHC CLASS I ANTIGEN H2-M3 (chains A, D) GSHSLRYFHTAVSRPGRGEPQYISVGYVDDVQFQRCDSIEEIPRMEPRAPWMEKERPEYW KELKLKVKNIAQSARANLRTLLRYYNQSEGGSHILQWMVSCEVGPDMRLLGAHYQAAYDG SDYITLNEDLSSWTAVDMVSQITKSRLESAGTAEYFRAYVEGECLELLHRFLRNGKEILQ RADPPKAHVAHHPRPKGDVTLRCWALGFYPADITLTWQKDEEDLTQDMELVETRPSGDGT FQKWAAVVVPSGEEQRYTCYVHHEGLTEPLALKWRSHHHHHH
>1MHC_2 MHC CLASS I ANTIGEN H2-M3 (chains B, E) IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDW SFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
>1MHC_3 NONAPEPTIDE FROM RAT NADH DEHYDROGENASE (chains C, F) MYFINILTL
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Nonclassical binding of formylated peptide in crystal structure of the MHC class Ib molecule H2-M3. Wang, C.R., Castano, A.R., Peterson, P.A. et al. Cell (1995) 82:655-664. DOI 10.1016/0092-8674(95)90037-3 · PubMed
Other PDB entries of the same protein (UniProt Q31093 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1MHC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.