Structure of the Neurospora SET domain protein DIM-5, a histone lysine methyltransferase. Determined by X-ray diffraction at 1.98 Å resolution. Released 23 Oct 2002.
Explore 1ML9 in 3D Show helices and sheets RCSB PDB PDBe
1ML9 contains 17 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-31 | 4 | 1 |
| β-strand | 44-45 | 2 | 2 |
| α-helix | 49 | 1 | |
| β-strand | 50-51 | 2 | 3 |
| α-helix | 52 | 1 | |
| α-helix | 60-62 | 3 | |
| α-helix | 73-75 | 3 | |
| α-helix | 80-82 | 3 | |
| β-strand | 104 | 1 | 4 |
| β-strand | 105 | 1 | 5 |
| β-strand | 111 | 1 | 5 |
| β-strand | 114 | 1 | 4 |
| α-helix | 115 | 1 | |
| α-helix | 116-121 | 6 | |
| β-strand | 125-126 | 2 | 6 |
| α-helix | 142-145 | 4 | |
| β-strand | 151-155 | 5 | 1 |
| β-strand | 161-164 | 4 | 1 |
| β-strand | 169 | 1 | 7 |
| β-strand | 174-177 | 4 | 6 |
| β-strand | 181-183 | 3 | 3 |
| α-helix | 185-194 | 10 | |
| α-helix | 197-199 | 3 | |
| α-helix | 201-204 | 4 | |
| β-strand | 205-207 | 3 | 3 |
| α-helix | 219-222 | 4 | |
| α-helix | 224-226 | 3 | |
| β-strand | 227-229 | 3 | 3 |
| β-strand | 233-234 | 2 | 2 |
| α-helix | 236-239 | 4 | |
| α-helix | 240 | 1 | |
| β-strand | 241-242 | 2 | 8 |
| β-strand | 248-254 | 7 | 6 |
| α-helix | 257-262 | 6 | |
| β-strand | 264-269 | 6 | 6 |
| β-strand | 273 | 1 | 7 |
| α-helix | 277 | 1 | |
| β-strand | 278-279 | 2 | 1 |
| β-strand | 280-281 | 2 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone H3 methyltransferase DIM-5 | A | protein | 302 | Neurospora crassa | Q8X225 (AlphaFold model) |
>1ML9_1 Histone H3 methyltransferase DIM-5 (chains A) IRSFATHAQLPISIVNREDDAFLNPNFRFIDHSIIGKNVPVADQSFRVGCSCASDEECMY STCQCLDEMAPDSDEEADPYTRKKRFAYYSQGAKKGLLRDRVLQSQEPIYECHQGCACSK DCPNRVVERGRTVPLQIFRTKDRGWGVKCPVNIKRGQFVDRYLGEIITSEEADRRRAEST IARRKDVYLFALDKFSDPDSLDPLLAGQPLEVDGEYMSGPTRFINHSCDPNMAIFARVGD HADKHIHDLALFAIKDIPKGTELTFDYVNGLTGLESDAHDPSKISEMTKCLCGTAKCRGY LW
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Water and common crystallization additives (UNL) are not listed.
Structure of the Neurospora SET domain protein DIM-5, a histone H3 lysine methyltransferase. Zhang, X., Tamaru, H., Khan, S.I. et al. Cell (2002) 111:117-127. DOI 10.1016/S0092-8674(02)00999-6 · PubMed
Other PDB entries of the same protein (UniProt Q8X225 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ML9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.