1MN3: Cue domain of yeast Vps9p

Cue domain of yeast Vps9p. Determined by X-ray diffraction at 2.3 Å resolution. Released 10 Jun 2003.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 456
Mol. weight: 6.22 kDa
Released: 10 Jun 2003

Explore 1MN3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MN3 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	399-419	21
α-helix	425-432	8
α-helix	439-450	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associated protein VPS9	A	protein	54	Saccharomyces cerevisiae	P54787 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MN3_1 Vacuolar protein sorting-associated protein VPS9 (chains A)
SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAKKSRIEPCVDALLSLSE

Primary citation

Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p. Prag, G., Misra, S., Jones, E.A. et al. Cell (2003) 113:609-620. DOI 10.1016/S0092-8674(03)00364-7 · PubMed

Other PDB entries of the same protein (UniProt P54787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1P3Q 1.7 Å, Mechanism of Ubiquitin Recognition by the CUE Domain of VPS9

Browse structure collections

About this viewer

MolViewer shows 1MN3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.