Pleckstrin homology domain from mouse beta-spectrin, NMR, 50 structures. Determined by solution NMR. Released 16 Jun 1997.
Explore 1MPH in 3D Show helices and sheets RCSB PDB PDBe
1MPH contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-11 | 10 | 1 |
| β-strand | 16 | 1 | 2 |
| β-strand | 18 | 1 | 2 |
| β-strand | 23-31 | 9 | 1 |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 41-46 | 6 | |
| β-strand | 55-57 | 3 | 1 |
| β-strand | 62-66 | 5 | 1 |
| β-strand | 69 | 1 | 3 |
| β-strand | 72 | 1 | 3 |
| β-strand | 75-79 | 5 | 1 |
| β-strand | 85-89 | 5 | 1 |
| α-helix | 93-104 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta spectrin | A | protein | 106 | Mus musculus | Q62261 (AlphaFold model) |
>1MPH_1 BETA SPECTRIN (chains A) MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKE AICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA
Automated NOESY interpretation with ambiguous distance restraints: the refined NMR solution structure of the pleckstrin homology domain from beta-spectrin. Nilges, M., Macias, M.J., O'Donoghue, S.I. et al. J Mol Biol (1997) 269:408-422. DOI 10.1006/jmbi.1997.1044 · PubMed
Other PDB entries of the same protein (UniProt Q62261 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1MPH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.