Crystal structure of dutpase from mycobacterium tuberculosis (RV2697C). Determined by X-ray diffraction at 1.95 Å resolution. Released 9 Oct 2002.
Explore 1MQ7 in 3D Show helices and sheets RCSB PDB PDBe
1MQ7 contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-9 | 4 | 1 |
| α-helix | 15-17 | 3 | |
| β-strand | 26-30 | 5 | 2 |
| β-strand | 35-37 | 3 | 3 |
| β-strand | 42-52 | 11 | 1 |
| α-helix | 53-54 | 2 | |
| β-strand | 57-62 | 6 | 2 |
| α-helix | 67-70 | 4 | |
| β-strand | 73-75 | 3 | 1 |
| β-strand | 80-82 | 3 | 2 |
| β-strand | 89-96 | 8 | 1 |
| β-strand | 103-105 | 3 | 3 |
| α-helix | 106 | 1 | |
| β-strand | 110-118 | 9 | 2 |
| α-helix | 122-124 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Deoxyuridine 5'-triphosphate nucleotidohydrolase | A | protein | 154 | Mycobacterium tuberculosis | P9WNS5 (AlphaFold model) |
>1MQ7_1 DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE (chains A) MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVE LVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL
Crystal structure of the Mycobacterium tuberculosis dUTPase: insights into the catalytic mechanism. Chan, S., Segelke, B., Lekin, T. et al. J Mol Biol (2004) 341:503-517. DOI 10.1016/j.jmb.2004.06.028 · PubMed
Other PDB entries of the same protein (UniProt P9WNS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1MQ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.