1MVU: Single chain fv of C219 heavy chain V101L mutant

Single chain fv of C219 heavy chain V101L mutant in complex with synthetic epitope peptide. Determined by X-ray diffraction at 1.78 Å resolution. Released 7 Oct 2003.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Mus musculus
Chains: 3
Atoms: 2,104
Mol. weight: 27.54 kDa
Released: 7 Oct 2003

Explore 1MVU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MVU contains 8 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-12	3	2
β-strand	19-25	7	1
β-strand	30-31	2	3
β-strand	36-37	2	3
β-strand	39-44	6	2
β-strand	51-55	5	2
β-strand	59-60	2	2
α-helix	61	1
β-strand	68-73	6	1
β-strand	76-81	6	1
α-helix	86-88	3
β-strand	91-96	6	2
α-helix	102	1
β-strand	103-104	2	2
β-strand	108-111	4	2

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	4
α-helix	7-9	3
β-strand	10-11	2	5
β-strand	18-25	8	4
α-helix	29-31	3
β-strand	32-39	8	5
β-strand	45-52	8	5
β-strand	57-60	4	5
α-helix	62-64	3
β-strand	68-73	6	4
β-strand	78-83	6	4
α-helix	88-90	3
β-strand	92-100	9	5
β-strand	110-111	2	5
β-strand	115-118	4	5

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig kappa-chain VJ-region (Light chain)	A	protein	114	Mus musculus	Q6KB05 (AlphaFold model)
Ig VDJ-region (HEAVY CHAIN)	B	protein	121	Mus musculus	Q505N9 (AlphaFold model)
P-glycoprotein	P	protein	13		P21448 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MVU_1 Ig kappa-chain VJ-region (Light chain) (chains A)
DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTR
ESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEPKR

Sequence of entity 2 (B), FASTA

>1MVU_2 Ig VDJ-region (HEAVY CHAIN) (chains B)
EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNTKY
APKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARRELYSYYSPLDVWGAGTTVTVP
S

Sequence of entity 3 (P), FASTA

>1MVU_3 P-GLYCOPROTEIN (chains P)
VVQEALDKAREGR

Primary citation

Single Chain C219 V(101H)L Mutant Antibody Complexed with a Helical Peptide. Chan, D.C.M., Hirama, T., Mackenzie, C.R. et al. To be published.

Other PDB entries of the same protein (UniProt Q6KB05 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AP2 2.4 Å, Single chain fv of C219 in complex with synthetic epitope peptide

Browse structure collections

About this viewer

MolViewer shows 1MVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.