Crystal Structure of Cytochrome c550 from Thermosynechococcus elongatus. Determined by X-ray diffraction at 1.8 Å resolution. Released 23 Sept 2003.
Explore 1MZ4 in 3D Show helices and sheets RCSB PDB PDBe
1MZ4 contains 11 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-8 | 4 | |
| β-strand | 9-11 | 3 | 1 |
| β-strand | 18-20 | 3 | 1 |
| α-helix | 23-36 | 14 | |
| α-helix | 38-41 | 4 | |
| α-helix | 42-44 | 3 | |
| α-helix | 50-52 | 3 | |
| α-helix | 56-60 | 5 | |
| α-helix | 69-77 | 9 | |
| β-strand | 80 | 1 | 2 |
| β-strand | 87 | 1 | 2 |
| α-helix | 95-97 | 3 | |
| α-helix | 102-104 | 3 | |
| α-helix | 109-126 | 18 | |
| α-helix | 127-129 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cytochrome c550 | A | protein | 137 | Thermosynechococcus elongatus | P0A386 (AlphaFold model) |
>1MZ4_1 cytochrome c550 (chains A) AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLA LATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHIL VEPKILGDKWGGGKVYY
Water and common crystallization additives (GOL) are not listed.
Structural and EPR characterization of the soluble form of cytochrome c-550 and of the psbV2 gene product from the cyanobacterium Thermosynechococcus elongatus. Kerfeld, C.A., Sawaya, M.R., Bottin, H. et al. Plant Cell Physiol (2003) 44:697-706. DOI 10.1093/pcp/pcg084 · PubMed
Other PDB entries of the same protein (UniProt P0A386 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1MZ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.