1N4D: Vitamin B12 transport protein btuF

Name: PDB 1N4D: The Ligand-Free Structure of E coli BtuF, the Periplasmic Binding Protein for Vitamin B12
Published: 2003-03-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transport protein

The Ligand-Free Structure of E coli BtuF, the Periplasmic Binding Protein for Vitamin B12. Determined by X-ray diffraction at 3.0 Å resolution. Released 11 Mar 2003.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Escherichia coli
Chains: 2
Atoms: 3,661
Mol. weight: 56.28 kDa
Released: 11 Mar 2003

Explore 1N4D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N4D contains 25 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
α-helix	9-17	9
β-strand	24-25	2	1
α-helix	33-37	5
β-strand	40	1	1
α-helix	49-55	7
β-strand	59-62	4	1
α-helix	64-66	3
α-helix	69-77	9
β-strand	82-84	3	1
α-helix	90-100	11
α-helix	101-103	3
α-helix	108-127	20
β-strand	134-136	3	2
β-strand	137-138	2	3
α-helix	153-160	8
β-strand	163-165	3	2
α-helix	166-169	4
α-helix	179-184	6
β-strand	190-192	3	3
β-strand	214-216	3	3
α-helix	217-218	2
α-helix	219-222	4
α-helix	229-241	13

Chain B: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	1004-1006	3	4
α-helix	1009-1017	9
β-strand	1025	1	5
α-helix	1033-1037	5
β-strand	1040	1	5
β-strand	1042	1	6
β-strand	1047	1	6
α-helix	1049-1055	7
β-strand	1059-1062	4	4
α-helix	1069-1077	9
β-strand	1082-1084	3	4
α-helix	1090-1099	10
α-helix	1101-1103	3
α-helix	1107-1124	18
β-strand	1134-1136	3	7
β-strand	1137-1138	2	8
α-helix	1153-1160	8
β-strand	1163-1165	3	7
α-helix	1181-1185	5
β-strand	1190-1192	3	8
β-strand	1214-1216	3	8
α-helix	1219-1222	4
α-helix	1229-1240	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vitamin B12 transport protein btuF	A, B	protein	252	Escherichia coli	P37028 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1N4D_1 Vitamin B12 transport protein btuF (chains A, B)
APRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLV
IAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQ
YAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSRE
QVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNAL
SQVDLEHHHHHH

Primary citation

Crystal Structures of the BtuF Periplasmic-binding Protein for Vitamin B12 Suggest a Functionally Important Reduction in Protein Mobility upon Ligand Binding. Karpowich, N.K., Huang, H.H., Smith, P.C. et al. J Biol Chem (2003) 278:8429-8434. DOI 10.1074/jbc.M212239200 · PubMed

Other PDB entries of the same protein (UniProt P37028 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M29 1.5 Å, Structure of cobinamide-bound BtuF, the periplasmic vitamin B12 binding protein in E.coli
5M3B 1.5 Å, Structure of cobinamide-bound BtuF mutant W66L, the periplasmic vitamin B12 binding…
5M34 1.6 Å, Structure of cobinamide-bound BtuF mutant W66Y, the periplasmic vitamin B12 binding…
5M2Q 1.7 Å, Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding…
1N2Z 2.0 Å, 2.0 Angstrom structure of BtuF, the vitamin B12 binding protein of E. coli
1N4A 2.0 Å, The Ligand Bound Structure of E.coli BtuF, the Periplasmic Binding Protein for Vitamin B12
2QI9 2.6 Å, ABC-transporter BtuCD in complex with its periplasmic binding protein BtuF
5OVW 2.65 Å, Nanobody-bound BtuF, the vitamin B12 binding protein in Escherichia coli
4FI3 3.47 Å, Structure of vitamin B12 transporter BtuCD-F in a nucleotide-bound state
4DBL 3.49 Å, Crystal structure of E159Q mutant of BtuCDF

Browse structure collections

About this viewer

MolViewer shows 1N4D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.