1N4H: Nuclear Receptor ROR-beta

Characterization of ligands for the orphan nuclear receptor RORbeta. Determined by X-ray diffraction at 2.1 Å resolution. Released 23 Sept 2003.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,201
Mol. weight: 31.67 kDa
Ligands: REA
Released: 23 Sept 2003

Explore 1N4H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N4H contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	2-19	18
α-helix	24-30	7
β-strand	34	1	1
α-helix	37-45	9
α-helix	48-71	24
α-helix	74-77	4
α-helix	81-100	20
α-helix	101-103	3
β-strand	104-105	2	1
β-strand	110-113	4	1
β-strand	116-118	3	1
α-helix	120-126	7
α-helix	129-143	15
α-helix	149-160	12
α-helix	171-191	21
α-helix	198-203	6
α-helix	206-226	21
α-helix	228-233	6
α-helix	237-243	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	692-699	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear Receptor ROR-beta	A	protein	259	Rattus norvegicus	P45446 (AlphaFold model)
Steroid Receptor Coactivator-1	B	protein	15		Q15788 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1N4H_1 Nuclear Receptor ROR-beta (chains A)
GQLAPGITMSEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQ
QCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLF
EGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLLEPRK
VQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPDIVNT
LFPPLYKELFNPDCAAVCK

Sequence of entity 2 (B), FASTA

>1N4H_2 Steroid Receptor Coactivator-1 (chains B)
RHKILHRLLQEGSPS

Ligands and cofactors

ID	Name	Formula	Copies
REA	Retinoic acid	C20 H28 O2	1

Primary citation

All-trans retinoic acid is a ligand for the orphan nuclear receptor RORbeta. Stehlin-Gaon, C., Willmann, D., Zeyer, D. et al. Nat Struct Biol (2003) 10:820-825. DOI 10.1038/nsb979 · PubMed

Other PDB entries of the same protein (UniProt P45446 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NQ7 1.5 Å, Characterization of ligands for the orphan nuclear receptor RORbeta
1K4W 1.9 Å, X-ray structure of the orphan nuclear receptor ROR beta ligand-binding domain in the…

Browse structure collections

About this viewer

MolViewer shows 1N4H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.