Crystal Structure of Human Rab5a A30L mutant complex with GppNHp. Determined by X-ray diffraction at 1.55 Å resolution. Released 27 Nov 2002.
Explore 1N6R in 3D Show helices and sheets RCSB PDB PDBe
1N6R contains 8 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-27 | 11 | 1 |
| α-helix | 33-42 | 10 | |
| α-helix | 49-52 | 4 | |
| β-strand | 55-64 | 10 | 1 |
| β-strand | 67-76 | 10 | 1 |
| α-helix | 80-85 | 6 | |
| α-helix | 86-90 | 5 | |
| β-strand | 95-101 | 7 | 1 |
| α-helix | 105-121 | 17 | |
| β-strand | 127-133 | 7 | 1 |
| α-helix | 135-140 | 6 | |
| α-helix | 145-154 | 10 | |
| β-strand | 158-161 | 4 | 1 |
| α-helix | 170-180 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ras-related protein Rab-5A | A | protein | 170 | Homo sapiens | P20339 (AlphaFold model) |
>1N6R_1 Ras-related protein Rab-5A (chains A) GNKICQFKLVLLGESLVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIW DTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNK ADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKN
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
| GNP | Phosphoaminophosphonic acid-guanylate ester | C10 H17 N6 O13 P3 | 1 |
Water and common crystallization additives (BME) are not listed.
High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop. Zhu, G., Liu, J., Terzyan, S. et al. J Biol Chem (2003) 278:2452-2460. DOI 10.1074/jbc.M211042200 · PubMed
Other PDB entries of the same protein (UniProt P20339 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1N6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.