1N7S: Truncated Neuronal SNARE Complex

High Resolution Structure of a Truncated Neuronal SNARE Complex. Determined by X-ray diffraction at 1.45 Å resolution. Released 27 Dec 2002.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 2,547
Mol. weight: 32.1 kDa
Ligands: CA
Released: 27 Dec 2002

Explore 1N7S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N7S contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	29-88	60

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	192-254	63

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-82	76

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	142-201	60

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
vesicle-associated membrane protein 2	A	protein	63	Rattus norvegicus	P63045 (AlphaFold model)
Syntaxin 1A	B	protein	68	Rattus norvegicus	P32851 (AlphaFold model)
Snap-25A	C	protein	79	Rattus norvegicus	P60881 (AlphaFold model)
Snap-25A	D	protein	66	Rattus norvegicus	P60881 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1N7S_1 vesicle-associated membrane protein 2 (chains A)
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKR
KYW

Sequence of entity 2 (B), FASTA

>1N7S_2 Syntaxin 1A (chains B)
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
SDTKKAVK

Sequence of entity 3 (C), FASTA

>1N7S_3 SNAP-25A (chains C)
GSMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGM
NHINQDMKEAEKNLKDLGK

Sequence of entity 4 (D), FASTA

>1N7S_4 SNAP-25A (chains D)
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQR
ATKMLG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Water and common crystallization additives (MPD) are not listed.

Primary citation

High Resolution Structure, Stability, and Synaptotagmin Binding of a Truncated Neuronal SNARE Complex. Ernst, J.A., Brunger, A.T. J Biol Chem (2003) 278:8630-8636. DOI 10.1074/jbc.M211889200 · PubMed

Other PDB entries of the same protein (UniProt P63045 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W5C 1.85 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2AB complex
6WVW 2.11 Å, Crystal structure of the R59P-SNAP25 containing SNARE complex
1KIL 2.3 Å, Three-dimensional structure of the complexin/SNARE complex
1SFC 2.4 Å, Neuronal synaptic fusion complex
5W5D 2.5 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2B complex
6A30 2.79 Å, Crystal Structure of Munc13-1 MUN Domain and Synaptobrevin-2 Juxtamembrane Linker Region
3HD7 3.4 Å, Helical extension of the neuronal snare complex into the membrane, spacegroup C 1 2 1
5CCG 3.5 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (long unit cell form)
7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
5CCH 3.6 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (short unit cell form)
6IP1 3.9 Å, alpha-SNAP-SNARE subcomplex in the whole 20S complex
5CCI 4.1 Å, Structure of the Mg2+-bound synaptotagmin-1 SNARE complex (short unit cell form)

Browse structure collections

About this viewer

MolViewer shows 1N7S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.