1NEZ: TL/CD8aa Complex

The Crystal Structure of a TL/CD8aa Complex at 2.1A resolution:Implications for Memory T cell Generation, Co-receptor Preference and Affinity. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 Apr 2003.

Method: X-ray diffraction
Resolution: 2.1 Å
Chains: 4
Atoms: 5,194
Mol. weight: 73.04 kDa
Ligands: NAG
Released: 8 Apr 2003

Explore 1NEZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NEZ contains 15 α-helices and 54 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	1
β-strand	22-28	7	1
β-strand	31-37	7	1
β-strand	41	1	2
β-strand	43	1	2
β-strand	44-47	4	1
α-helix	50-53	4
α-helix	57-76	20
α-helix	78-84	7
β-strand	93-104	12	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-150	13
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-178	14
β-strand	183	1	3
α-helix	184-185	2
β-strand	186-193	8	4
β-strand	199-208	10	4
β-strand	209	1	3
β-strand	214-219	6	5
β-strand	222-223	2	5
β-strand	228-230	3	4
α-helix	231-233	3
β-strand	234-235	2	4
β-strand	241-249	9	4
α-helix	254-256	3
β-strand	257-262	6	5
β-strand	270-273	4	5

Chain B: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	6
β-strand	6-11	6	7
β-strand	21-30	10	7
β-strand	31	1	6
β-strand	36-41	6	8
β-strand	44-45	2	8
β-strand	50-51	2	7
β-strand	55-56	2	7
β-strand	62-70	9	7
β-strand	78-83	6	8
β-strand	91-94	4	8

Chain G: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	9
β-strand	14-16	3	10
α-helix	17	1
β-strand	22-29	8	9
β-strand	36-42	7	10
β-strand	51-56	6	10
β-strand	63-65	3	10
α-helix	71-73	3
β-strand	75-80	6	9
β-strand	84-89	6	9
α-helix	94-96	3
β-strand	98-106	9	10
β-strand	109-112	4	10
β-strand	116-120	5	10
α-helix	121-122	2

Chain H: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	11
β-strand	14-15	2	12
β-strand	22-29	8	11
β-strand	36-42	7	12
β-strand	51-56	6	12
β-strand	63-65	3	12
α-helix	69-71	3
β-strand	75-79	5	11
β-strand	84-89	6	11
β-strand	98-106	9	12
β-strand	109-112	4	12
β-strand	116-119	4	12

Molecules and chains

Molecule	Chains	Type	Length	UniProt
H-2 class I histocompatibility antigen, TLA(C) alpha chain	A	protein	274	P14432 (AlphaFold model)
Beta-2-microglobulin	B	protein	99	P01887 (AlphaFold model)
T-cell surface glycoprotein CD8 alpha chain	G, H	protein	128	P01731 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NEZ_1 H-2 class I histocompatibility antigen, TLA(C) alpha chain (chains A)
GSHSLRYFYTALSRPAISEPWYIAVGYLDDTQFARFDSAGETGTYKLSAPWVEQEGPEYW
ARETEIVTSNAQFFRENLQTMLDYYNLSQNGSHTIQVMYGCEVEFFGSLFRAYEQHGYDG
QDYIALNEDLKTWTAADMAAEITRSKWEQAGYTELRRTYLEGPCKDSLLRYLENRKKTQE
CTDPPKTHVTHHARPEGDVTLRCWALGFYPAHITLTWQLNGEELIQDTELVETRPAGDGT
FQKWAAVVVPSGEEQKYTCHVYHEGLPEPLTLRW

Sequence of entity 2 (B), FASTA

>1NEZ_2 Beta-2-microglobulin (chains B)
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDW
SFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

Sequence of entity 3 (G, H), FASTA

>1NEZ_3 T-cell surface glycoprotein CD8 alpha chain (chains G, H)
KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSH
NKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQ
KVSSALVP

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

The Crystal Structure of a TL/CD8alphaalpha Complex at 2.1 A resolution: Implications for modulation of T cell activation and memory. Liu, Y., Xiong, Y., Naidenko, O.V. et al. Immunity (2003) 18:205-215. DOI 10.1016/S1074-7613(03)00027-X · PubMed

Browse structure collections

About this viewer

MolViewer shows 1NEZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.