1NQ7: Nuclear receptor ror-beta

Characterization of ligands for the orphan nuclear receptor RORbeta. Determined by X-ray diffraction at 1.5 Å resolution. Released 23 Sept 2003.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,464
Mol. weight: 29.8 kDa
Ligands: ARL
Released: 23 Sept 2003

Explore 1NQ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NQ7 contains 18 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	209-226	18
α-helix	231-237	7
α-helix	240	1
β-strand	241	1	1
α-helix	242-243	2
α-helix	244-252	9
α-helix	255-278	24
α-helix	281-284	4
α-helix	288-307	20
α-helix	308-310	3
β-strand	311-312	2	1
β-strand	317-320	4	1
β-strand	323-326	4	1
α-helix	327-333	7
α-helix	336-350	15
α-helix	356-367	12
α-helix	378-399	22
α-helix	405-411	7
α-helix	413-433	21
α-helix	435-440	6
α-helix	444-450	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	688-695	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor ror-beta	A	protein	244	Rattus norvegicus	P45446 (AlphaFold model)
Steroid receptor coactivator-1	B	protein	10		Q15788 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NQ7_1 NUCLEAR RECEPTOR ROR-BETA (chains A)
TMSEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQIT
HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGM
QMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLLEPRKVQKLQEK
IYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYK
ELFN

Sequence of entity 2 (B), FASTA

>1NQ7_2 STEROID RECEPTOR COACTIVATOR-1 (chains B)
HKILHRLLQE

Ligands and cofactors

ID	Name	Formula	Copies
ARL	7-(3,5-ditert-butylphenyl)-3-methylocta-2,4,6-trienoic acid	C23 H32 O2	1

Primary citation

All-trans retinoic acid is a ligand for the orphan nuclear receptor RORbeta. Stehlin-Gaon, C., Willmann, D., Zeyer, D. et al. Nat Struct Biol (2003) 10:820-825. DOI 10.1038/nsb979 · PubMed

Other PDB entries of the same protein (UniProt P45446 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1K4W 1.9 Å, X-ray structure of the orphan nuclear receptor ROR beta ligand-binding domain in the…
1N4H 2.1 Å, Characterization of ligands for the orphan nuclear receptor RORbeta

Browse structure collections

About this viewer

MolViewer shows 1NQ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.