1NTK: Mitochondrial Cytochrome bc1
Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Antimycin A1. Determined by X-ray diffraction at 2.6 Å resolution. Released 7 Oct 2003.
- Method
- X-ray diffraction
- Resolution
- 2.6 Å
- Organism
- Bos taurus
- Chains
- 11
- Atoms
- 17,118
- Mol. weight
- 241.75 kDa
- Ligands
- HEM, AY1, FES
- Released
- 7 Oct 2003
Explore 1NTK in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1NTK contains 115 α-helices and 61 β-strands across 11 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 24 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-10 | 7 | |
| α-helix | 12-14 | 3 | |
| β-strand | 15-18 | 4 | 1 |
| β-strand | 24-29 | 6 | 1 |
| β-strand | 34-41 | 8 | 1 |
| α-helix | 55-63 | 9 | |
| β-strand | 66 | 1 | 2 |
| β-strand | 67 | 1 | 3 |
| β-strand | 71 | 1 | 2 |
| α-helix | 74-81 | 8 | |
| β-strand | 85-90 | 6 | 1 |
| β-strand | 95-102 | 8 | 1 |
| α-helix | 103-105 | 3 | |
| α-helix | 106-118 | 13 | |
| β-strand | 120 | 1 | 3 |
| α-helix | 124-141 | 18 | |
| α-helix | 145-157 | 13 | |
| α-helix | 162-164 | 3 | |
| α-helix | 171-176 | 6 | |
| α-helix | 179-189 | 11 | |
| α-helix | 192-194 | 3 | |
| β-strand | 195-201 | 7 | 1 |
| α-helix | 205-215 | 11 | |
| α-helix | 231-233 | 3 | |
| β-strand | 239-244 | 6 | 4 |
| β-strand | 251-259 | 9 | 4 |
| α-helix | 266-277 | 12 | |
| β-strand | 279-281 | 3 | 4 |
| β-strand | 284 | 1 | 5 |
| α-helix | 293-300 | 8 | |
| β-strand | 306-311 | 6 | 4 |
| β-strand | 314 | 1 | 6 |
| β-strand | 317 | 1 | 6 |
| β-strand | 318-326 | 9 | 4 |
| α-helix | 331-348 | 18 | |
| α-helix | 351-368 | 18 | |
| α-helix | 372-385 | 14 | |
| α-helix | 392-401 | 10 | |
| α-helix | 404-415 | 12 | |
| α-helix | 418-420 | 3 | |
| β-strand | 421-426 | 6 | 4 |
| α-helix | 432-433 | 2 | |
| α-helix | 434-439 | 6 | |
Chain B: 25 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-24 | 3 | |
| β-strand | 25-28 | 4 | 5 |
| β-strand | 34-38 | 5 | 5 |
| β-strand | 44-51 | 8 | 5 |
| α-helix | 55-57 | 3 | |
| α-helix | 65-70 | 6 | |
| β-strand | 77 | 1 | 7 |
| α-helix | 82-91 | 10 | |
| β-strand | 95-100 | 6 | 5 |
| β-strand | 105-112 | 8 | 5 |
| α-helix | 113-115 | 3 | |
| α-helix | 116-128 | 13 | |
| β-strand | 130 | 1 | 7 |
| α-helix | 134-138 | 5 | |
| α-helix | 141-151 | 11 | |
| α-helix | 155-167 | 13 | |
| β-strand | 168 | 1 | 8 |
| α-helix | 180-182 | 3 | |
| α-helix | 188-198 | 11 | |
| α-helix | 201-203 | 3 | |
| β-strand | 204-209 | 6 | 5 |
| α-helix | 213-222 | 10 | |
| β-strand | 239 | 1 | 8 |
| β-strand | 242-247 | 6 | 9 |
| β-strand | 252-260 | 9 | 9 |
| α-helix | 267-279 | 13 | |
| β-strand | 285 | 1 | 1 |
| α-helix | 294-302 | 9 | |
| β-strand | 307-316 | 10 | 9 |
| β-strand | 319-329 | 11 | 9 |
| α-helix | 330-332 | 3 | |
| α-helix | 333-348 | 16 | |
| α-helix | 354-371 | 18 | |
| α-helix | 375-389 | 15 | |
| α-helix | 395-403 | 9 | |
| α-helix | 407-419 | 13 | |
| α-helix | 421 | 1 | |
| β-strand | 422-428 | 7 | 9 |
| α-helix | 430-432 | 3 | |
| α-helix | 433-435 | 3 | |
| α-helix | 436-438 | 3 | |
Chain C: 22 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-7 | 4 | |
| α-helix | 9-18 | 10 | |
| β-strand | 22-24 | 3 | 10 |
| α-helix | 29-31 | 3 | |
| α-helix | 33-52 | 20 | |
| α-helix | 62-71 | 10 | |
| α-helix | 76-104 | 29 | |
| α-helix | 106-108 | 3 | |
| α-helix | 110-132 | 23 | |
| β-strand | 136 | 1 | 11 |
| α-helix | 137-148 | 12 | |
| α-helix | 149-152 | 4 | |
| α-helix | 157-163 | 7 | |
| α-helix | 172-201 | 30 | |
| α-helix | 214-216 | 3 | |
| β-strand | 217-219 | 3 | 10 |
| α-helix | 223-245 | 23 | |
| β-strand | 258 | 1 | 11 |
| α-helix | 272-274 | 3 | |
| α-helix | 275-282 | 8 | |
| α-helix | 287-299 | 13 | |
| α-helix | 301-307 | 7 | |
| α-helix | 319-339 | 21 | |
| α-helix | 345-360 | 16 | |
| α-helix | 361-365 | 5 | |
| α-helix | 366-377 | 12 | |
Chain D: 11 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 19-21 | 3 | |
| α-helix | 23-35 | 13 | |
| α-helix | 37-39 | 3 | |
| β-strand | 43-47 | 5 | 12 |
| α-helix | 48-54 | 7 | |
| α-helix | 58-66 | 9 | |
| β-strand | 70 | 1 | 13 |
| α-helix | 72-74 | 3 | |
| β-strand | 83 | 1 | 13 |
| β-strand | 90-91 | 2 | 12 |
| α-helix | 99-104 | 6 | |
| α-helix | 116-118 | 3 | |
| α-helix | 124-133 | 10 | |
| β-strand | 149 | 1 | 14 |
| β-strand | 157 | 1 | 14 |
| α-helix | 179-194 | 16 | |
| α-helix | 198-231 | 34 | |
| β-strand | 234-237 | 4 | 4 |
Chain E: 10 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-4 | 3 | |
| α-helix | 6-9 | 4 | |
| β-strand | 14 | 1 | 15 |
| α-helix | 16-18 | 3 | |
| α-helix | 29-63 | 35 | |
| β-strand | 74-77 | 4 | 16 |
| α-helix | 78-80 | 3 | |
| β-strand | 86-91 | 6 | 17 |
| β-strand | 94-100 | 7 | 17 |
| α-helix | 103-110 | 8 | |
| α-helix | 114-116 | 3 | |
| α-helix | 123-125 | 3 | |
| β-strand | 132-136 | 5 | 17 |
| α-helix | 146 | 1 | |
| β-strand | 147-148 | 2 | 18 |
| β-strand | 154-158 | 5 | 18 |
| β-strand | 163-166 | 4 | 18 |
| β-strand | 171-173 | 3 | 18 |
| α-helix | 179-181 | 3 | |
| β-strand | 185-187 | 3 | 16 |
| β-strand | 192-195 | 4 | 16 |
Chain F: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-24 | 15 | |
| α-helix | 26-29 | 4 | |
| α-helix | 33-36 | 4 | |
| α-helix | 41-49 | 9 | |
| α-helix | 52-71 | 20 | |
| α-helix | 77-79 | 3 | |
| α-helix | 91-107 | 17 | |
Chain G: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 13-18 | 6 | 4 |
| α-helix | 20-22 | 3 | |
| β-strand | 23 | 1 | 15 |
| α-helix | 33-70 | 38 | |
Chain H: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-12 | 9 | |
| α-helix | 16-24 | 9 | |
| α-helix | 28-46 | 19 | |
| α-helix | 55-72 | 18 | |
| α-helix | 73-75 | 3 | |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial | A | protein | 446 | Bos taurus | P31800 (AlphaFold model) |
| Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial | B | protein | 439 | Bos taurus | P23004 (AlphaFold model) |
| Cytochrome b | C | protein | 379 | Bos taurus | P00157 (AlphaFold model) |
| cytochrome c1 | D | protein | 241 | Bos taurus | P00125 (AlphaFold model) |
| Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial | E | protein | 196 | Bos taurus | P13272 |
| Ubiquinol-cytochrome C reductase complex 14 kDa protein | F | protein | 110 | Bos taurus | P00129 |
| Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C | G | protein | 81 | Bos taurus | P13271 |
| Ubiquinol-cytochrome C reductase complex 11 kDa protein | H | protein | 78 | Bos taurus | P00126 |
| Ubiquinol-cytochrome C reductase 8 kDa protein | I | protein | 57 | Bos taurus | P13272 |
| Ubiquinol-cytochrome C reductase complex 7.2 kDa protein | J | protein | 62 | Bos taurus | P00130 |
| Ubiquinol-cytochrome C reductase complex 6.4 kDa protein | K | protein | 56 | Bos taurus | P07552 |
Sequence of entity 1 (A), FASTA
>1NTK_1 Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial (chains A)
TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVE
HLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNC
SLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRA
DLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQ
ICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAAT
NKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNL
LRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCP
AVAGFGPIEQLPDYNRIRSGMFWLRF
Sequence of entity 2 (B), FASTA
>1NTK_2 Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial (chains B)
SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENS
NNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILM
EFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPD
YRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYH
GGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVA
KGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAA
KNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSG
RKSMAASGNLGHTPFIDEL
Sequence of entity 3 (C), FASTA
>1NTK_3 Cytochrome b (chains C)
MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTT
TAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILL
LTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFA
FHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM
LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILI
LALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFL
LILVLMPTAGTIENKLLKW
Sequence of entity 4 (D), FASTA
>1NTK_4 cytochrome c1 (chains D)
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDE
AKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRAR
HGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMS
QVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
K
Sequence of entity 5 (E), FASTA
>1NTK_5 UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT, MITOCHONDRIAL (chains E)
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVS
SMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDP
QHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNL
EVPSYEFTSDDMVIVG
Sequence of entity 6 (F), FASTA
>1NTK_6 Ubiquinol-cytochrome C reductase complex 14 kDa protein (chains F)
AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVF
RIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK
Sequence of entity 7 (G), FASTA
>1NTK_7 Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C (chains G)
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYT
WGTQEFEKSKRKNPAAYENDR
Sequence of entity 8 (H), FASTA
>1NTK_8 Ubiquinol-cytochrome C reductase complex 11 kDa protein (chains H)
GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLD
FLHARDHCVAHKLFNSLK
Sequence of entity 9 (I), FASTA
>1NTK_9 Ubiquinol-cytochrome C reductase 8 kDa protein (chains I)
MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRG
Sequence of entity 10 (J), FASTA
>1NTK_10 Ubiquinol-cytochrome C reductase complex 7.2 kDa protein (chains J)
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYE
NK
Sequence of entity 11 (K), FASTA
>1NTK_11 Ubiquinol-cytochrome C reductase complex 6.4 kDa protein (chains K)
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 3 |
| AY1 | [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-… | C27 H38 N2 O9 | 1 |
| FES | FE2/S2 (inorganic) cluster | Fe2 S2 | 1 |
Primary citation
Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site. Gao, X., Wen, X., Esser, L. et al. Biochemistry (2003) 42:9067-9080. DOI 10.1021/bi0341814 · PubMed
Other PDB entries of the same protein (UniProt P31800 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1PP9 2.1 Å, Bovine cytochrome bc1 complex with stigmatellin bound
- 1PPJ 2.1 Å, Bovine cytochrome bc1 complex with stigmatellin and antimycin
- 2A06 2.1 Å, Bovine cytochrome bc1 complex with stigmatellin bound
- 9W2X 2.2 Å, Cryo-EM structure of complex III on the bovine heart submitochondrial particles, III-1
- 2FYU 2.26 Å, Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
- 1L0L 2.35 Å, structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
- 1NTM 2.4 Å, Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom
- 9W2Y 2.4 Å, Cryo-EM structure of complex III on the bovine heart submitochondrial particles, III-2
- 1L0N 2.6 Å, native structure of bovine mitochondrial cytochrome bc1 complex
- 1NTZ 2.6 Å, Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone
- 1SQX 2.6 Å, Crystal Structure Analysis of Bovine Bc1 with Stigmatellin A
- 5KLV 2.65 Å, Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Browse structure collections
About this viewer
MolViewer shows 1NTK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.