1NYM: Beta-lactamase TEM

Crystal Structure of the complex between M182T mutant of TEM-1 and a boronic acid inhibitor (CXB). Determined by X-ray diffraction at 1.2 Å resolution. Released 26 Aug 2003.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Escherichia coli
Chains: 1
Atoms: 2,952
Mol. weight: 29.48 kDa
Ligands: CXB, PO4
Released: 26 Aug 2003

Explore 1NYM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NYM contains 14 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	27-40	14
β-strand	43-50	8	1
β-strand	56-60	5	1
β-strand	66-67	2	2
α-helix	69-71	3
α-helix	72-85	14
β-strand	94-95	2	3
α-helix	99-101	3
α-helix	109-111	3
β-strand	117-118	2	3
α-helix	119-128	10
α-helix	132-142	11
α-helix	145-154	10
α-helix	168-170	3
β-strand	180-181	2	2
α-helix	183-193	11
α-helix	201-212	12
α-helix	221-224	4
α-helix	225-226	2
β-strand	230-237	8	1
β-strand	244-251	8	1
β-strand	259-266	8	1
α-helix	272-288	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-lactamase TEM	A	protein	263	Escherichia coli	P62593 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NYM_1 Beta-lactamase TEM (chains A)
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVD
AGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGP
KELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQ
QLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTG
SQATMDERNRQIAEIGASLIKHW

Ligands and cofactors

ID	Name	Formula	Copies
CXB	[(2-amino-alpha-methoxyimino-4-thiazolylacetyl)amino]methylboronic acid	C7 H11 B N4 O4 S	1
PO4	Phosphate ion	O4 P	2

Water and common crystallization additives (K) are not listed.

Primary citation

Recognition and resistance in TEM beta-lactamase. Wang, X., Minasov, G., Caselli, E. et al. Biochemistry (2003) 42:8434-8444. DOI 10.1021/bi034242y · PubMed

Other PDB entries of the same protein (UniProt P62593 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1M40 0.85 Å, Ultra high resolution crystal structure of tem-1
4ID4 1.05 Å, Crystal structure of chimeric beta-lactamase cTEM-17m
4R4S 1.1 Å, Crystal structure of chimeric beta-lactamase cTEM-19m at 1.1 angstrom resolution
4QY6 1.15 Å, Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
4R4R 1.2 Å, Crystal structure of chimeric beta-lactamase cTEM-19m at 1.2 angstrom resolution
4RX3 1.39 Å, A triple mutant in the omega-loop of TEM-1 beta-lactamase changes the substrate profile…
1YT4 1.4 Å, Crystal structure of TEM-76 beta-lactamase at 1.4 Angstrom resolution
5HW5 1.41 Å, Crystal structure of TEM1 beta-lactamase in the presence of 2.0 MPa xenon
4RVA 1.44 Å, A triple mutant in the omega-loop of TEM-1 beta-lactamase changes the substrate profile…
6AYK 1.44 Å, Crystal structure of TEM1 beta-lactamase mutant I263A in the presence of 1.2 MPa xenon
1PZP 1.45 Å, TEM-1 Beta-Lactamase in Complex with a Novel, Core-Disrupting, Allosteric Inhibitor
8DDZ 1.45 Å, TEM-1 beta-lactamase A237Y

Browse structure collections

About this viewer

MolViewer shows 1NYM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.