crystal structure of Uracil-DNA glycosylase from Atlantic cod (Gadus morhua). Determined by X-ray diffraction at 1.9 Å resolution. Released 5 Apr 2004.
Explore 1OKB in 3D Show helices and sheets RCSB PDB PDBe
1OKB contains 30 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 87-92 | 6 | |
| α-helix | 94-98 | 5 | |
| α-helix | 100-115 | 16 | |
| β-strand | 118-119 | 2 | 1 |
| α-helix | 122-124 | 3 | |
| α-helix | 127-129 | 3 | |
| α-helix | 134-136 | 3 | |
| β-strand | 139-143 | 5 | 2 |
| α-helix | 165-167 | 3 | |
| α-helix | 168-180 | 13 | |
| α-helix | 193-196 | 4 | |
| β-strand | 200-204 | 5 | 2 |
| β-strand | 209-210 | 2 | 1 |
| β-strand | 213 | 1 | 1 |
| α-helix | 222-236 | 15 | |
| β-strand | 241-245 | 5 | 2 |
| α-helix | 247-252 | 6 | |
| α-helix | 253-255 | 3 | |
| β-strand | 262-266 | 5 | 2 |
| α-helix | 274-276 | 3 | |
| α-helix | 283-293 | 11 | |
| α-helix | 297-299 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uracil-DNA glycosylase | A, B | protein | 223 | GADUS MORHUA | Q9I983 (AlphaFold model) |
>1OKB_1 URACIL-DNA GLYCOSYLASE (chains A, B) MEFFGETWRRELAAEFEKPYFKQLMSFVADERSRHTVYPPADQVYSWTEMCDIQDVKVVI LGQDPYHGPNQAHGLCFSVQKPVPPPPSLVNIYKELCTDIDGFKHPGHGDLSGWAKQGVL LLNAVLTVRAHQANSHKDRGWETFTDAVIKWLSVNREGVVFLLWGSYAHKKGATIDRKRH HVLQAVHPSPLSAHRGFLGCKHFSKANGLLKLSGTEPINWRAL
The Crystal Structure of Uracil-DNA Glycosylase from Atlantic Cod (Gadus Morhua) Reveals Cold-Adaptation Features. Leiros, I., Moe, E., Lanes, O. et al. Acta Crystallogr D Biol Crystallogr (2003) 59:1357. DOI 10.1107/S0907444903011144 · PubMed
Other PDB entries of the same protein (UniProt Q9I983 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1OKB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.