1OOJ: Calmodulin CMD-1

Structural genomics of Caenorhabditis elegans : Calmodulin. Determined by X-ray diffraction at 2.11 Å resolution. Released 25 Mar 2003.

Method: X-ray diffraction
Resolution: 2.11 Å
Organism: Caenorhabditis elegans
Chains: 1
Atoms: 1,206
Mol. weight: 17 kDa
Ligands: CA
Released: 25 Mar 2003

Explore 1OOJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OOJ contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
β-strand	27-28	2	1
α-helix	30-39	10
α-helix	46-54	9
β-strand	64-65	2	1
α-helix	66-93	28
β-strand	100-101	2	2
α-helix	103-111	9
α-helix	119-129	11
β-strand	137-138	2	2
α-helix	139-145	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin CMD-1	A	protein	149	Caenorhabditis elegans	O16305 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OOJ_1 Calmodulin CMD-1 (chains A)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVTMMTTK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Structural genomics of caenorhabditis elegans: crystal structure of calmodulin. Symersky, J., Lin, G., Li, S. et al. Proteins (2003) 53:947-949. DOI 10.1002/prot.10517 · PubMed

Other PDB entries of the same protein (UniProt O16305 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H7D 2.57 Å, Crystal structure of the YgjG-protein A-Zpa963-calmodulin complex

Browse structure collections

About this viewer

MolViewer shows 1OOJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.