Structural genomics of Caenorhabditis elegans : Calmodulin. Determined by X-ray diffraction at 2.11 Å resolution. Released 25 Mar 2003.
Explore 1OOJ in 3D Show helices and sheets RCSB PDB PDBe
1OOJ contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-20 | 12 | |
| β-strand | 27-28 | 2 | 1 |
| α-helix | 30-39 | 10 | |
| α-helix | 46-54 | 9 | |
| β-strand | 64-65 | 2 | 1 |
| α-helix | 66-93 | 28 | |
| β-strand | 100-101 | 2 | 2 |
| α-helix | 103-111 | 9 | |
| α-helix | 119-129 | 11 | |
| β-strand | 137-138 | 2 | 2 |
| α-helix | 139-145 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calmodulin CMD-1 | A | protein | 149 | Caenorhabditis elegans | O16305 (AlphaFold model) |
>1OOJ_1 Calmodulin CMD-1 (chains A) MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVTMMTTK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 4 |
Structural genomics of caenorhabditis elegans: crystal structure of calmodulin. Symersky, J., Lin, G., Li, S. et al. Proteins (2003) 53:947-949. DOI 10.1002/prot.10517 · PubMed
Other PDB entries of the same protein (UniProt O16305 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1OOJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.