1OPK: The auto-inhibition of c-Abl tyrosine kinase

Structural basis for the auto-inhibition of c-Abl tyrosine kinase. Determined by X-ray diffraction at 1.8 Å resolution. Released 8 Apr 2003.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Mus musculus
Chains: 1
Atoms: 3,933
Mol. weight: 56.94 kDa
Ligands: MYR, P16
Released: 8 Apr 2003

Explore 1OPK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OPK contains 30 α-helices and 34 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	84-87	4	1
β-strand	91	1	2
β-strand	98	1	1
β-strand	101	1	2
β-strand	106-112	7	1
β-strand	118-122	5	1
β-strand	127-131	5	1
α-helix	132-134	3
β-strand	135-137	3	1
α-helix	141-143	3
β-strand	147-150	4	3
α-helix	153-159	7
α-helix	160-162	3
β-strand	167-172	6	3
β-strand	180-186	7	3
β-strand	189-194	6	3
α-helix	195	1
β-strand	196-197	2	4
β-strand	203-204	2	4
β-strand	211	1	4
α-helix	214-221	8
β-strand	226	1	5
β-strand	228	1	5
β-strand	234-235	2	3
α-helix	236-237	2
α-helix	241-243	3
β-strand	255	1	6
α-helix	258-260	3
β-strand	261-266	6	6
α-helix	268-270	3
β-strand	275-280	6	6
α-helix	281-283	3
β-strand	285-291	7	6
α-helix	299-311	13
β-strand	317	1	7
β-strand	320-324	5	6
α-helix	330	1
β-strand	331-335	5	6
β-strand	341	1	7
α-helix	342-348	7
α-helix	356-375	20
β-strand	378-379	2	8
α-helix	385-387	3
β-strand	388-390	3	7
α-helix	392-394	3
β-strand	396-398	3	7
β-strand	404-405	2	8
β-strand	408	1	9
β-strand	410	1	9
β-strand	412-413	2	10
α-helix	414-415	2
α-helix	422-424	3
α-helix	427-432	6
β-strand	434-435	2	10
α-helix	437-452	16
α-helix	456-457	2
α-helix	464-466	3
α-helix	467-472	6
α-helix	477-480	4
α-helix	485-494	10
α-helix	499-501	3
α-helix	503-504	2
α-helix	505-513	9
α-helix	521-530	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene tyrosine-protein kinase ABL1	A	protein	495	Mus musculus	P00520 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OPK_1 Proto-oncogene tyrosine-protein kinase ABL1 (chains A)
GAMDPSEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTL
SITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYL
LSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVH
HHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGV
WKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTY
GNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRNLAARNCLVGENHLVKVA
DFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPY
PGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES
SISDEVEKELGKRGT

Ligands and cofactors

ID	Name	Formula	Copies
MYR	Myristic acid	C14 H28 O2	1
P16	6-(2,6-dichlorophenyl)-2-{[3-(hydroxymethyl)phenyl]amino}-8-METHYLPYRIDO[2,3-D]…	C21 H16 Cl2 N4 O2	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural basis for the autoinhibition of c-Abl tyrosine kinase. Nagar, B., Hantschel, O., Young, M.A. et al. Cell (2003) 112:859-871. DOI 10.1016/S0092-8674(03)00194-6 · PubMed

Other PDB entries of the same protein (UniProt P00520 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KFA 1.22 Å, Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl…
3K5V 1.74 Å, Structure of Abl kinase in complex with imatinib and GNF-2
1OPJ 1.75 Å, Structural basis for the auto-inhibition of c-Abl tyrosine kinase
3MS9 1.8 Å, ABL kinase in complex with imatinib and a fragment (FRAG1) in the myristate pocket
5IH2 1.8 Å, Structure, thermodynamics, and the role of conformational dynamics in the interactions…
3IK3 1.9 Å, AP24534, a Pan-BCR-ABL Inhibitor for Chronic Myeloid Leukemia, Potently Inhibits the…
3KF4 1.9 Å, Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl…
2QOH 1.95 Å, Crystal Structure of Abl kinase bound with PPY-A
2Z60 1.95 Å, Crystal Structure of the T315I Mutant of Abl kinase bound with PPY-A
3MSS 1.95 Å, Abl kinase in complex with imatinib and fragment (FRAG2) in the myristate site
3OY3 1.95 Å, Crystal structure of ABL T315I mutant kinase domain bound with a DFG-out inhibitor AP24589
1ABO 2.0 Å, Crystal structure of the complex of the abl tyrosine kinase SH3 domain with 3BP-1…

Browse structure collections

About this viewer

MolViewer shows 1OPK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.