1OSH: Bile acid receptor

A Chemical, Genetic, and Structural Analysis of the nuclear bile acid receptor FXR. Determined by X-ray diffraction at 1.8 Å resolution. Released 23 Sept 2003.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,984
Mol. weight: 27.58 kDa
Ligands: FEX
Released: 23 Sept 2003

Explore 1OSH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OSH contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	251-264	14
α-helix	287-307	21
α-helix	312-314	3
α-helix	317-338	22
α-helix	339-343	5
α-helix	346-357	12
α-helix	366-377	12
α-helix	383-394	12
α-helix	405-426	22
α-helix	433-445	13
α-helix	447-460	14
α-helix	467-473	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bile acid receptor	A	protein	232	Homo sapiens	Q96RI1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OSH_1 Bile acid receptor (chains A)
SHGELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVE
FTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDE
YITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCK
IHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

Ligands and cofactors

ID	Name	Formula	Copies
FEX	Methyl 3-{3-[(CYCLOHEXYLCARBONYL){[4'-(dimethylamino)biphenyl-4-yl]methyl}amino…	C32 H38 N2 O3	1

Primary citation

A chemical, genetic, and structural analysis of the nuclear bile acid receptor FXR. Downes, M., Verdecia, M.A., Roecker, A.J. et al. Mol Cell (2003) 11:1079-1092. DOI 10.1016/S1097-2765(03)00104-7 · PubMed

Other PDB entries of the same protein (UniProt Q96RI1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HL1 1.6 Å, Crystal Structure of Farnesoid X receptor (FXR) with bound NCoA-2 peptide and CDCA
6HL0 1.66 Å, Crystal Structure of Farnesoid X receptor (FXR) with bound NCoA-2 peptide
4OIV 1.7 Å, Structural basis for small molecule NDB as a selective antagonist of FXR
5Q0I 1.7 Å, Ligand binding to FARNESOID-X-RECEPTOR
5Q0K 1.8 Å, Ligand binding to FARNESOID-X-RECEPTOR
5Q0P 1.8 Å, Ligand binding to FARNESOID-X-RECEPTOR
5Q14 1.85 Å, Ligand binding to FARNESOID-X-RECEPTOR
5Q1E 1.85 Å, Ligand binding to FARNESOID-X-RECEPTOR
5Q0V 1.87 Å, Ligand binding to FARNESOID-X-RECEPTOR
5Q1D 1.89 Å, Ligand binding to FARNESOID-X-RECEPTOR
3BEJ 1.9 Å, Structure of human FXR in complex with MFA-1 and co-activator peptide
3L1B 1.9 Å, Complex Structure of FXR Ligand-binding domain with a tetrahydroazepinoindole compound

Browse structure collections

About this viewer

MolViewer shows 1OSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.