1P3Y: MrsD from Bacillus sp. HIL-Y85/54728

MrsD from Bacillus sp. HIL-Y85/54728. Determined by X-ray diffraction at 2.54 Å resolution. Released 5 Aug 2003.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Bacillus sp.
Chains: 1
Atoms: 1,461
Mol. weight: 22.49 kDa
Ligands: FAD
Released: 5 Aug 2003

Explore 1P3Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P3Y contains 14 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-15	6	1
α-helix	19-23	5
α-helix	25-31	7
β-strand	37-42	6	1
α-helix	44-49	6
α-helix	52-55	4
α-helix	56-58	3
β-strand	61-63	3	1
α-helix	72-74	3
α-helix	75-81	7
β-strand	84-90	7	1
α-helix	92-99	8
α-helix	106-113	8
β-strand	119-122	4	1
α-helix	126-129	4
α-helix	132-144	13
β-strand	147-148	2	1
α-helix	149-151	3
β-strand	152	1	2
β-strand	169	1	2
α-helix	173-183	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MrsD protein	1	protein	194	Bacillus sp.	Q9RC23 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>1P3Y_1 MrsD protein (chains 1)
MSISILKDKKLLIGICGSISSVGISSYLLYFKSFFKEIRVVMTKTAEDLIPAHTVSYFCD
HVYSEHGENGKRHSHVEIGRWADIYCIIPATANILGQTANGVAMNLVATTVLAHPHNTIF
FPNMNDLMWNKTVVSRNIEQLRKDGHIVIEPVEIMAFEIATGTRKPNRGLITPDKALLAI
EKGFKERTKHPSLT

Ligands and cofactors

ID	Name	Formula	Copies
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	1

Primary citation

Structure of MrsD, an FAD-binding protein of the HFCD family. Blaesse, M., Kupke, T., Huber, R. et al. Acta Crystallogr D Biol Crystallogr (2003) 59:1414-1421. DOI 10.1107/S0907444903011831 · PubMed

Other PDB entries of the same protein (UniProt Q9RC23 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H75 2.74 Å, Crystal structure of the MrsD-Protein A fusion protein

Browse structure collections

About this viewer

MolViewer shows 1P3Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.